Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1345189..1346106 | Replicon | chromosome |
Accession | NZ_CP128551 | ||
Organism | Bacillus velezensis strain SRCM123441 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | QTN52_RS06765 | Protein ID | WP_007407256.1 |
Coordinates | 1345360..1346106 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | QTN52_RS06760 | Protein ID | WP_003154807.1 |
Coordinates | 1345189..1345359 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN52_RS06710 (1340396) | 1340396..1340908 | + | 513 | WP_017417605.1 | sigma-70 family RNA polymerase sigma factor | - |
QTN52_RS06715 (1341021) | 1341021..1341572 | + | 552 | Protein_1262 | terminase | - |
QTN52_RS06720 (1341683) | 1341683..1342045 | + | 363 | WP_014721043.1 | hypothetical protein | - |
QTN52_RS06725 (1342058) | 1342058..1342429 | + | 372 | WP_017417608.1 | XkdW family protein | - |
QTN52_RS06730 (1342434) | 1342434..1342631 | + | 198 | WP_007610833.1 | XkdX family protein | - |
QTN52_RS06735 (1342688) | 1342688..1343449 | + | 762 | WP_017417609.1 | hypothetical protein | - |
QTN52_RS06740 (1343500) | 1343500..1343763 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
QTN52_RS06745 (1343777) | 1343777..1344040 | + | 264 | WP_003154813.1 | phage holin | - |
QTN52_RS06750 (1344054) | 1344054..1344932 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
QTN52_RS06755 (1344967) | 1344967..1345092 | - | 126 | WP_003154809.1 | hypothetical protein | - |
QTN52_RS06760 (1345189) | 1345189..1345359 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
QTN52_RS06765 (1345360) | 1345360..1346106 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QTN52_RS06770 (1346210) | 1346210..1347208 | - | 999 | WP_017417610.1 | inorganic phosphate transporter | - |
QTN52_RS06775 (1347221) | 1347221..1347838 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
QTN52_RS06780 (1348125) | 1348125..1349441 | - | 1317 | WP_134986489.1 | amino acid permease | - |
QTN52_RS06785 (1349763) | 1349763..1350713 | + | 951 | WP_007610844.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T284878 WP_007407256.1 NZ_CP128551:c1346106-1345360 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|