Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 481330..481967 | Replicon | chromosome |
Accession | NZ_CP128551 | ||
Organism | Bacillus velezensis strain SRCM123441 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QTN52_RS02435 | Protein ID | WP_003156187.1 |
Coordinates | 481617..481967 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | QTN52_RS02430 | Protein ID | WP_003156188.1 |
Coordinates | 481330..481611 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN52_RS02410 (477695) | 477695..478294 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
QTN52_RS02415 (478387) | 478387..478752 | + | 366 | WP_014304402.1 | holo-ACP synthase | - |
QTN52_RS02420 (478917) | 478917..479924 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
QTN52_RS02425 (480041) | 480041..481210 | + | 1170 | WP_104843106.1 | alanine racemase | - |
QTN52_RS02430 (481330) | 481330..481611 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QTN52_RS02435 (481617) | 481617..481967 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QTN52_RS02440 (482085) | 482085..482906 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
QTN52_RS02445 (482911) | 482911..483276 | + | 366 | WP_007609584.1 | RsbT antagonist protein RsbS | - |
QTN52_RS02450 (483279) | 483279..483680 | + | 402 | WP_134986389.1 | anti-sigma regulatory factor | - |
QTN52_RS02455 (483692) | 483692..484699 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
QTN52_RS02460 (484763) | 484763..485092 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
QTN52_RS02465 (485089) | 485089..485571 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
QTN52_RS02470 (485537) | 485537..486325 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
QTN52_RS02475 (486325) | 486325..486927 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T284877 WP_003156187.1 NZ_CP128551:481617-481967 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|