Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-higA/HigB-HigA |
| Location | 290308..291299 | Replicon | chromosome |
| Accession | NZ_CP128550 | ||
| Organism | Pseudomonas alloputida strain NMI5594_09 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | LU693_RS01240 | Protein ID | WP_020190010.1 |
| Coordinates | 290308..290784 (+) | Length | 159 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | Q88R60 |
| Locus tag | LU693_RS01245 | Protein ID | WP_004575922.1 |
| Coordinates | 290826..291299 (+) | Length | 158 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU693_RS01220 (LU693_001220) | 285451..286818 | - | 1368 | WP_010951639.1 | ATP-binding protein | - |
| LU693_RS01225 (LU693_001225) | 286820..287539 | - | 720 | WP_010951640.1 | response regulator | - |
| LU693_RS01230 (LU693_001230) | 287680..289977 | + | 2298 | WP_010951641.1 | TonB-dependent siderophore receptor | - |
| LU693_RS01235 (LU693_001235) | 290043..290249 | - | 207 | WP_014860378.1 | DUF3079 domain-containing protein | - |
| LU693_RS01240 (LU693_001240) | 290308..290784 | + | 477 | WP_020190010.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| LU693_RS01245 (LU693_001245) | 290826..291299 | + | 474 | WP_004575922.1 | transcriptional regulator | Antitoxin |
| LU693_RS01250 (LU693_001250) | 291304..291491 | - | 188 | Protein_239 | integrase | - |
| LU693_RS01255 (LU693_001255) | 291719..291934 | + | 216 | WP_010951644.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LU693_RS01260 (LU693_001260) | 291931..292254 | - | 324 | WP_010951645.1 | helix-turn-helix transcriptional regulator | - |
| LU693_RS01265 (LU693_001265) | 292821..295289 | - | 2469 | WP_161989609.1 | hypothetical protein | - |
| LU693_RS01270 (LU693_001270) | 295464..295739 | - | 276 | WP_080516504.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 159 a.a. Molecular weight: 18386.38 Da Isoelectric Point: 10.3522
>T284870 WP_020190010.1 NZ_CP128550:290308-290784 [Pseudomonas alloputida]
MTGINPLAIARSPYIAHPDIWLTDIWIGDIFHPMLVRRDNTMRVITKAAVTKAIEVHGQWKAPLSLWLTTFDRATLRFES
FEQLRQTWATVSGWNVDRIPHSKLRPASRKGPLDIYVFDIKKNECRLIAWLNARTGTLYIKAILSHAEYDKWCRSDIR
MTGINPLAIARSPYIAHPDIWLTDIWIGDIFHPMLVRRDNTMRVITKAAVTKAIEVHGQWKAPLSLWLTTFDRATLRFES
FEQLRQTWATVSGWNVDRIPHSKLRPASRKGPLDIYVFDIKKNECRLIAWLNARTGTLYIKAILSHAEYDKWCRSDIR
Download Length: 477 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17229.67 Da Isoelectric Point: 4.4982
>AT284870 WP_004575922.1 NZ_CP128550:290826-291299 [Pseudomonas alloputida]
MKRDKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIKDDAELEARMALIDELYSHADSEGHAAARFAEMVADR
VYEYESESVLVPFASQAEALAFLLSDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQIKGFAEFFSVPVEFFMHGVV
MKRDKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIKDDAELEARMALIDELYSHADSEGHAAARFAEMVADR
VYEYESESVLVPFASQAEALAFLLSDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQIKGFAEFFSVPVEFFMHGVV
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|