Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4814746..4815262 | Replicon | chromosome |
| Accession | NZ_CP128549 | ||
| Organism | Pseudomonas monteilii strain NMI985_06 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3G2HKE7 |
| Locus tag | LU680_RS22765 | Protein ID | WP_016712032.1 |
| Coordinates | 4814746..4815033 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A446A2J5 |
| Locus tag | LU680_RS22770 | Protein ID | WP_028700126.1 |
| Coordinates | 4815023..4815262 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU680_RS22750 (LU680_22750) | 4809785..4812664 | + | 2880 | WP_016712029.1 | ribonucleoside-diphosphate reductase subunit alpha | - |
| LU680_RS22755 (LU680_22755) | 4812804..4812935 | + | 132 | WP_016712030.1 | hypothetical protein | - |
| LU680_RS22760 (LU680_22760) | 4813382..4814632 | + | 1251 | WP_016712031.1 | ribonucleotide-diphosphate reductase subunit beta | - |
| LU680_RS22765 (LU680_22765) | 4814746..4815033 | - | 288 | WP_016712032.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LU680_RS22770 (LU680_22770) | 4815023..4815262 | - | 240 | WP_028700126.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| LU680_RS22775 (LU680_22775) | 4815863..4817101 | + | 1239 | WP_016712034.1 | OprD family porin | - |
| LU680_RS22780 (LU680_22780) | 4817265..4818071 | + | 807 | WP_016712035.1 | NAD(P)-dependent oxidoreductase | - |
| LU680_RS22785 (LU680_22785) | 4818098..4818979 | + | 882 | WP_016712036.1 | SMP-30/gluconolactonase/LRE family protein | - |
| LU680_RS22790 (LU680_22790) | 4819045..4820016 | + | 972 | WP_063977227.1 | TRAP transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11233.07 Da Isoelectric Point: 9.9006
>T284868 WP_016712032.1 NZ_CP128549:c4815033-4814746 [Pseudomonas monteilii]
MTYSLDFDCRALKEWKKLGDTVREQFKKKLAEVLLNPRVEANRLHSLPDCYKIKLRSSGYRLVYQVIGQEIVVFVVAVDR
RERDQAYKKAAERLE
MTYSLDFDCRALKEWKKLGDTVREQFKKKLAEVLLNPRVEANRLHSLPDCYKIKLRSSGYRLVYQVIGQEIVVFVVAVDR
RERDQAYKKAAERLE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G2HKE7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A446A2J5 |