Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3777472..3778093 | Replicon | chromosome |
| Accession | NZ_CP128549 | ||
| Organism | Pseudomonas monteilii strain NMI985_06 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2G8MXB6 |
| Locus tag | LU680_RS17700 | Protein ID | WP_016715573.1 |
| Coordinates | 3777472..3777654 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | LU680_RS17705 | Protein ID | WP_232859993.1 |
| Coordinates | 3777692..3778093 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU680_RS17665 (LU680_17665) | 3773151..3774839 | - | 1689 | WP_081011190.1 | terminase large subunit | - |
| LU680_RS17670 (LU680_17670) | 3774836..3775381 | - | 546 | WP_232891759.1 | terminase small subunit | - |
| LU680_RS17675 (LU680_17675) | 3775541..3775879 | - | 339 | WP_232859998.1 | HNH endonuclease signature motif containing protein | - |
| LU680_RS17680 (LU680_17680) | 3775879..3776037 | - | 159 | WP_232859997.1 | hypothetical protein | - |
| LU680_RS17685 (LU680_17685) | 3776041..3776238 | - | 198 | WP_232859996.1 | hypothetical protein | - |
| LU680_RS17690 (LU680_17690) | 3776243..3776566 | - | 324 | WP_232859995.1 | phage holin, lambda family | - |
| LU680_RS17695 (LU680_17695) | 3776624..3777184 | - | 561 | WP_232859994.1 | hypothetical protein | - |
| LU680_RS17700 (LU680_17700) | 3777472..3777654 | + | 183 | WP_016715573.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LU680_RS17705 (LU680_17705) | 3777692..3778093 | + | 402 | WP_232859993.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LU680_RS17710 (LU680_17710) | 3778856..3779542 | - | 687 | WP_232859992.1 | hypothetical protein | - |
| LU680_RS17715 (LU680_17715) | 3779554..3779871 | - | 318 | WP_232859991.1 | hypothetical protein | - |
| LU680_RS17720 (LU680_17720) | 3779868..3780119 | - | 252 | WP_121784280.1 | hypothetical protein | - |
| LU680_RS17725 (LU680_17725) | 3780143..3781432 | - | 1290 | WP_232889807.1 | site-specific integrase | - |
| LU680_RS17730 (LU680_17730) | 3781429..3781857 | - | 429 | WP_232889808.1 | VRR-NUC domain-containing protein | - |
| LU680_RS17735 (LU680_17735) | 3781854..3782150 | - | 297 | WP_159265956.1 | DUF1364 domain-containing protein | - |
| LU680_RS17740 (LU680_17740) | 3782175..3782858 | - | 684 | WP_232859986.1 | replication protein P | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3740535..3829731 | 89196 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6696.86 Da Isoelectric Point: 11.2336
>T284867 WP_016715573.1 NZ_CP128549:3777472-3777654 [Pseudomonas monteilii]
VQSRQLIKELEAAGWVLKRVTGSHHIFKHPNNPNSIPVPHPKKDLPIGTVKSIKERAGLK
VQSRQLIKELEAAGWVLKRVTGSHHIFKHPNNPNSIPVPHPKKDLPIGTVKSIKERAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14484.33 Da Isoelectric Point: 4.2585
>AT284867 WP_232859993.1 NZ_CP128549:3777692-3778093 [Pseudomonas monteilii]
MQYPICIEWGDENTATGIQIPDIPGAVTAGDTFEEAYSSAVEVAHIMLEEIASNGQAIPMPTSAAAHRGNPDFADMGWGM
LEIDITPYLGKTEKVNVTLPGFVIQQIDRYVRDHNVKSRSSFLADAAMEKLGR
MQYPICIEWGDENTATGIQIPDIPGAVTAGDTFEEAYSSAVEVAHIMLEEIASNGQAIPMPTSAAAHRGNPDFADMGWGM
LEIDITPYLGKTEKVNVTLPGFVIQQIDRYVRDHNVKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|