Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 4862844..4863430 | Replicon | chromosome |
| Accession | NZ_CP128548 | ||
| Organism | Pseudomonas kurunegalensis strain NMI3456_12 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | LU664_RS23115 | Protein ID | WP_082426425.1 |
| Coordinates | 4863137..4863430 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A923H277 |
| Locus tag | LU664_RS23110 | Protein ID | WP_060499950.1 |
| Coordinates | 4862844..4863140 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU664_RS23090 (LU664_023090) | 4859812..4860753 | - | 942 | WP_164525071.1 | FecR domain-containing protein | - |
| LU664_RS23095 (LU664_023095) | 4860753..4861265 | - | 513 | WP_164525274.1 | sigma-70 family RNA polymerase sigma factor | - |
| LU664_RS23100 (LU664_023100) | 4861555..4862202 | + | 648 | WP_060499948.1 | hypothetical protein | - |
| LU664_RS23105 (LU664_023105) | 4862354..4862842 | + | 489 | WP_164525072.1 | GNAT family N-acetyltransferase | - |
| LU664_RS23110 (LU664_023110) | 4862844..4863140 | - | 297 | WP_060499950.1 | putative addiction module antidote protein | Antitoxin |
| LU664_RS23115 (LU664_023115) | 4863137..4863430 | - | 294 | WP_082426425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LU664_RS23120 (LU664_023120) | 4863652..4864539 | + | 888 | WP_164525073.1 | bestrophin family ion channel | - |
| LU664_RS23125 (LU664_023125) | 4864536..4865303 | - | 768 | WP_060499952.1 | phosphonate ABC transporter, permease protein PhnE | - |
| LU664_RS23130 (LU664_023130) | 4865300..4866127 | - | 828 | WP_060499953.1 | ABC transporter permease subunit | - |
| LU664_RS23135 (LU664_023135) | 4866121..4866930 | - | 810 | WP_164525074.1 | ATP-binding cassette domain-containing protein | - |
| LU664_RS23140 (LU664_023140) | 4866927..4867781 | - | 855 | WP_164525075.1 | putative selenate ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10847.80 Da Isoelectric Point: 10.5184
>T284866 WP_082426425.1 NZ_CP128548:c4863430-4863137 [Pseudomonas kurunegalensis]
MYLVEQTESFAVWLSSLRDLKAKLAIGRRLERVAIGNLGDFKWLGGGLGELRIDVGAGYRVYFTQKGHRLVLLLVGGDKS
TQVADILKSRKLLKEMI
MYLVEQTESFAVWLSSLRDLKAKLAIGRRLERVAIGNLGDFKWLGGGLGELRIDVGAGYRVYFTQKGHRLVLLLVGGDKS
TQVADILKSRKLLKEMI
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|