Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 4856494..4857102 | Replicon | chromosome |
Accession | NZ_CP128548 | ||
Organism | Pseudomonas kurunegalensis strain NMI3456_12 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | LU664_RS23080 | Protein ID | WP_164525070.1 |
Coordinates | 4856812..4857102 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A6G6V4Q8 |
Locus tag | LU664_RS23075 | Protein ID | WP_060499944.1 |
Coordinates | 4856494..4856802 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LU664_RS23050 (LU664_023050) | 4851664..4853526 | - | 1863 | WP_060501849.1 | protein translocase subunit SecD | - |
LU664_RS23055 (LU664_023055) | 4853590..4853925 | - | 336 | WP_008092587.1 | preprotein translocase subunit YajC | - |
LU664_RS23060 (LU664_023060) | 4853968..4855083 | - | 1116 | WP_014589748.1 | tRNA guanosine(34) transglycosylase Tgt | - |
LU664_RS23065 (LU664_023065) | 4855098..4856147 | - | 1050 | WP_104834019.1 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | - |
LU664_RS23075 (LU664_023075) | 4856494..4856802 | - | 309 | WP_060499944.1 | putative addiction module antidote protein | Antitoxin |
LU664_RS23080 (LU664_023080) | 4856812..4857102 | - | 291 | WP_164525070.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LU664_RS23085 (LU664_023085) | 4857214..4859694 | - | 2481 | WP_225521444.1 | TonB-dependent receptor | - |
LU664_RS23090 (LU664_023090) | 4859812..4860753 | - | 942 | WP_164525071.1 | FecR domain-containing protein | - |
LU664_RS23095 (LU664_023095) | 4860753..4861265 | - | 513 | WP_164525274.1 | sigma-70 family RNA polymerase sigma factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10711.19 Da Isoelectric Point: 8.9632
>T284865 WP_164525070.1 NZ_CP128548:c4857102-4856812 [Pseudomonas kurunegalensis]
VKTILTTDDFDAWFSKLSDKRSAMRIQARIDRAEAGNFGDCQAVGEGVSEMRIHYGPGYRVYFTQRGLEIVILLAGGDKS
TQSKDIKTALDIARRL
VKTILTTDDFDAWFSKLSDKRSAMRIQARIDRAEAGNFGDCQAVGEGVSEMRIHYGPGYRVYFTQRGLEIVILLAGGDKS
TQSKDIKTALDIARRL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|