Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 3481866..3482500 Replicon chromosome
Accession NZ_CP128548
Organism Pseudomonas kurunegalensis strain NMI3456_12

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag LU664_RS16365 Protein ID WP_003291451.1
Coordinates 3481866..3482270 (-) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID L1LS63
Locus tag LU664_RS16370 Protein ID WP_003285520.1
Coordinates 3482270..3482500 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LU664_RS16340 (LU664_016340) 3478126..3478731 - 606 WP_164524682.1 hypothetical protein -
LU664_RS16345 (LU664_016345) 3478769..3479260 - 492 WP_164524683.1 hypothetical protein -
LU664_RS16350 (LU664_016350) 3479987..3480232 - 246 WP_206520096.1 hypothetical protein -
LU664_RS16355 (LU664_016355) 3480422..3480754 + 333 WP_036992178.1 hypothetical protein -
LU664_RS16360 (LU664_016360) 3480814..3481782 + 969 WP_164524684.1 DUF932 domain-containing protein -
LU664_RS16365 (LU664_016365) 3481866..3482270 - 405 WP_003291451.1 tRNA(fMet)-specific endonuclease VapC Toxin
LU664_RS16370 (LU664_016370) 3482270..3482500 - 231 WP_003285520.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
LU664_RS16375 (LU664_016375) 3482657..3483661 + 1005 WP_003291452.1 YqaJ viral recombinase family protein -
LU664_RS16380 (LU664_016380) 3483753..3484658 + 906 WP_164524685.1 hydrolase or metal-binding protein -
LU664_RS16385 (LU664_016385) 3484669..3485166 + 498 WP_116801388.1 DNA repair protein RadC -
LU664_RS16390 (LU664_016390) 3485177..3485347 + 171 WP_164524686.1 hypothetical protein -
LU664_RS16395 (LU664_016395) 3485443..3486516 - 1074 WP_232905531.1 BREX system Lon protease-like protein BrxL -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island aph(3'')-Ib / aph(6)-Id / blaVIM-2 / sul1 / tet(G) / floR / aac(6')-IIa / cmlA1 - 3466665..3547220 80555
- flank IS/Tn - - 3486833..3487693 860


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(7-35)


Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 14968.21 Da        Isoelectric Point: 7.2774

>T284864 WP_003291451.1 NZ_CP128548:c3482270-3481866 [Pseudomonas kurunegalensis]
MLKYMLDTNMCIFTIKNRPEQVREAFKRHSGQLSISTVTLMELIYGAEKSANPERNLADVEGFAARLEVLPYDAQAAAHS
GQLRAELARIGKPIGPYDQMIAGHARAQGLILVTNNLREFERVPGLRVEDWVSA

Download         Length: 405 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8432.41 Da        Isoelectric Point: 4.2683

>AT284864 WP_003285520.1 NZ_CP128548:c3482500-3482270 [Pseudomonas kurunegalensis]
MEQGAVFQSNRSQAVRLPKAVALPEDVKRVDVVVVGRARIITPAGEAWDVWFDGEGVTADYMADREQPADQERDAF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB L1LS63

References