Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
| Location | 3473687..3474240 | Replicon | chromosome |
| Accession | NZ_CP128548 | ||
| Organism | Pseudomonas kurunegalensis strain NMI3456_12 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | LU664_RS16320 | Protein ID | WP_164524678.1 |
| Coordinates | 3473687..3473980 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LU664_RS16325 | Protein ID | WP_096862010.1 |
| Coordinates | 3473968..3474240 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU664_RS16280 (LU664_016280) | 3468691..3468945 | + | 255 | WP_164524675.1 | hypothetical protein | - |
| LU664_RS16285 (LU664_016285) | 3468942..3469508 | + | 567 | WP_060497295.1 | hypothetical protein | - |
| LU664_RS16290 (LU664_016290) | 3469552..3469875 | + | 324 | WP_060497296.1 | helix-turn-helix transcriptional regulator | - |
| LU664_RS16295 (LU664_016295) | 3469931..3470257 | + | 327 | WP_060497297.1 | hypothetical protein | - |
| LU664_RS16300 (LU664_016300) | 3470320..3470496 | + | 177 | WP_164524676.1 | hypothetical protein | - |
| LU664_RS16305 (LU664_016305) | 3470516..3470920 | + | 405 | WP_232905530.1 | hypothetical protein | - |
| LU664_RS16310 (LU664_016310) | 3470806..3471969 | + | 1164 | Protein_3189 | tyrosine-type recombinase/integrase | - |
| LU664_RS16315 (LU664_016315) | 3472284..3473693 | + | 1410 | WP_164524677.1 | site-specific integrase | - |
| LU664_RS16320 (LU664_016320) | 3473687..3473980 | - | 294 | WP_164524678.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LU664_RS16325 (LU664_016325) | 3473968..3474240 | - | 273 | WP_096862010.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| LU664_RS16330 (LU664_016330) | 3474675..3476402 | - | 1728 | WP_217989239.1 | GTPase domain-containing protein | - |
| LU664_RS16335 (LU664_016335) | 3476389..3478125 | - | 1737 | WP_164524681.1 | hypothetical protein | - |
| LU664_RS16340 (LU664_016340) | 3478126..3478731 | - | 606 | WP_164524682.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | aph(3'')-Ib / aph(6)-Id / blaVIM-2 / sul1 / tet(G) / floR / aac(6')-IIa / cmlA1 | - | 3466665..3547220 | 80555 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11183.67 Da Isoelectric Point: 5.9081
>T284863 WP_164524678.1 NZ_CP128548:c3473980-3473687 [Pseudomonas kurunegalensis]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQVIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQVIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|