Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 343414..344020 | Replicon | chromosome |
Accession | NZ_CP128548 | ||
Organism | Pseudomonas kurunegalensis strain NMI3456_12 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A6G6UCX8 |
Locus tag | LU664_RS01495 | Protein ID | WP_060501213.1 |
Coordinates | 343414..343761 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A923H1P8 |
Locus tag | LU664_RS01500 | Protein ID | WP_025754068.1 |
Coordinates | 343772..344020 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LU664_RS01480 (LU664_001480) | 338847..340214 | - | 1368 | WP_164524045.1 | ATP-binding protein | - |
LU664_RS01485 (LU664_001485) | 340216..340938 | - | 723 | WP_060501217.1 | response regulator | - |
LU664_RS01490 (LU664_001490) | 341079..343376 | + | 2298 | WP_164524046.1 | TonB-dependent siderophore receptor | - |
LU664_RS01495 (LU664_001495) | 343414..343761 | - | 348 | WP_060501213.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LU664_RS01500 (LU664_001500) | 343772..344020 | - | 249 | WP_025754068.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
LU664_RS01505 (LU664_001505) | 344921..345820 | - | 900 | WP_164524047.1 | hypothetical protein | - |
LU664_RS01510 (LU664_001510) | 345823..346938 | - | 1116 | WP_164524048.1 | DUF3696 domain-containing protein | - |
LU664_RS01515 (LU664_001515) | 346935..348188 | - | 1254 | WP_206520113.1 | DUF262 domain-containing protein | - |
LU664_RS01520 (LU664_001520) | 348410..348685 | - | 276 | WP_232905541.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12751.62 Da Isoelectric Point: 6.6372
>T284862 WP_060501213.1 NZ_CP128548:c343761-343414 [Pseudomonas kurunegalensis]
MSKPTIRFTHSASQSIEDQVHHLAVYHGTAAALEKITTLVDTIEHRLAAAPVGYPVSPQASGLGVMQYRELNVDGYRVFY
EVIETDNAIAVGLVLRQKQSVEQALIRYCLIYPLP
MSKPTIRFTHSASQSIEDQVHHLAVYHGTAAALEKITTLVDTIEHRLAAAPVGYPVSPQASGLGVMQYRELNVDGYRVFY
EVIETDNAIAVGLVLRQKQSVEQALIRYCLIYPLP
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|