Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4761370..4761886 | Replicon | chromosome |
Accession | NZ_CP128547 | ||
Organism | Pseudomonas monteilii strain NMI10873_11 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3G2HKE7 |
Locus tag | LU655_RS22410 | Protein ID | WP_016712032.1 |
Coordinates | 4761370..4761657 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A446A2J5 |
Locus tag | LU655_RS22415 | Protein ID | WP_028700126.1 |
Coordinates | 4761647..4761886 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LU655_RS22395 (LU655_022395) | 4756409..4759288 | + | 2880 | WP_016712029.1 | ribonucleoside-diphosphate reductase subunit alpha | - |
LU655_RS22400 (LU655_022400) | 4759428..4759559 | + | 132 | WP_016712030.1 | hypothetical protein | - |
LU655_RS22405 (LU655_022405) | 4760006..4761256 | + | 1251 | WP_016712031.1 | ribonucleotide-diphosphate reductase subunit beta | - |
LU655_RS22410 (LU655_022410) | 4761370..4761657 | - | 288 | WP_016712032.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LU655_RS22415 (LU655_022415) | 4761647..4761886 | - | 240 | WP_028700126.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
LU655_RS22420 (LU655_022420) | 4762487..4763725 | + | 1239 | WP_016712034.1 | OprD family porin | - |
LU655_RS22425 (LU655_022425) | 4763889..4764695 | + | 807 | WP_016712035.1 | NAD(P)-dependent oxidoreductase | - |
LU655_RS22430 (LU655_022430) | 4764722..4765603 | + | 882 | WP_016712036.1 | SMP-30/gluconolactonase/LRE family protein | - |
LU655_RS22435 (LU655_022435) | 4765669..4766640 | + | 972 | WP_063977227.1 | TRAP transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11233.07 Da Isoelectric Point: 9.9006
>T284860 WP_016712032.1 NZ_CP128547:c4761657-4761370 [Pseudomonas monteilii]
MTYSLDFDCRALKEWKKLGDTVREQFKKKLAEVLLNPRVEANRLHSLPDCYKIKLRSSGYRLVYQVIGQEIVVFVVAVDR
RERDQAYKKAAERLE
MTYSLDFDCRALKEWKKLGDTVREQFKKKLAEVLLNPRVEANRLHSLPDCYKIKLRSSGYRLVYQVIGQEIVVFVVAVDR
RERDQAYKKAAERLE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G2HKE7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A446A2J5 |