Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3545919..3546540 | Replicon | chromosome |
| Accession | NZ_CP128547 | ||
| Organism | Pseudomonas monteilii strain NMI10873_11 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2G8MXB6 |
| Locus tag | LU655_RS16355 | Protein ID | WP_016715573.1 |
| Coordinates | 3545919..3546101 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | LU655_RS16360 | Protein ID | WP_232859993.1 |
| Coordinates | 3546139..3546540 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU655_RS16320 (LU655_016320) | 3541598..3543286 | - | 1689 | WP_081011190.1 | terminase large subunit | - |
| LU655_RS16325 (LU655_016325) | 3543283..3543828 | - | 546 | WP_060709079.1 | terminase | - |
| LU655_RS16330 (LU655_016330) | 3543988..3544326 | - | 339 | WP_232859998.1 | HNH endonuclease signature motif containing protein | - |
| LU655_RS16335 (LU655_016335) | 3544326..3544484 | - | 159 | WP_232859997.1 | hypothetical protein | - |
| LU655_RS16340 (LU655_016340) | 3544488..3544685 | - | 198 | WP_232859996.1 | hypothetical protein | - |
| LU655_RS16345 (LU655_016345) | 3544690..3545013 | - | 324 | WP_232859995.1 | phage holin, lambda family | - |
| LU655_RS16350 (LU655_016350) | 3545071..3545631 | - | 561 | WP_232859994.1 | hypothetical protein | - |
| LU655_RS16355 (LU655_016355) | 3545919..3546101 | + | 183 | WP_016715573.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LU655_RS16360 (LU655_016360) | 3546139..3546540 | + | 402 | WP_232859993.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LU655_RS16365 (LU655_016365) | 3547303..3547989 | - | 687 | WP_232859992.1 | hypothetical protein | - |
| LU655_RS16370 (LU655_016370) | 3548001..3548318 | - | 318 | WP_232859991.1 | hypothetical protein | - |
| LU655_RS16375 (LU655_016375) | 3548315..3548566 | - | 252 | WP_121784280.1 | hypothetical protein | - |
| LU655_RS16380 (LU655_016380) | 3548590..3549879 | - | 1290 | WP_232889807.1 | site-specific integrase | - |
| LU655_RS16385 (LU655_016385) | 3549876..3550304 | - | 429 | WP_232889808.1 | VRR-NUC domain-containing protein | - |
| LU655_RS16390 (LU655_016390) | 3550301..3550597 | - | 297 | WP_159265956.1 | DUF1364 domain-containing protein | - |
| LU655_RS16395 (LU655_016395) | 3550600..3551412 | - | 813 | WP_232889809.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3507721..3568269 | 60548 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6696.86 Da Isoelectric Point: 11.2336
>T284859 WP_016715573.1 NZ_CP128547:3545919-3546101 [Pseudomonas monteilii]
VQSRQLIKELEAAGWVLKRVTGSHHIFKHPNNPNSIPVPHPKKDLPIGTVKSIKERAGLK
VQSRQLIKELEAAGWVLKRVTGSHHIFKHPNNPNSIPVPHPKKDLPIGTVKSIKERAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14484.33 Da Isoelectric Point: 4.2585
>AT284859 WP_232859993.1 NZ_CP128547:3546139-3546540 [Pseudomonas monteilii]
MQYPICIEWGDENTATGIQIPDIPGAVTAGDTFEEAYSSAVEVAHIMLEEIASNGQAIPMPTSAAAHRGNPDFADMGWGM
LEIDITPYLGKTEKVNVTLPGFVIQQIDRYVRDHNVKSRSSFLADAAMEKLGR
MQYPICIEWGDENTATGIQIPDIPGAVTAGDTFEEAYSSAVEVAHIMLEEIASNGQAIPMPTSAAAHRGNPDFADMGWGM
LEIDITPYLGKTEKVNVTLPGFVIQQIDRYVRDHNVKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|