Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4675331..4675847 | Replicon | chromosome |
Accession | NZ_CP128546 | ||
Organism | Pseudomonas monteilii strain NMI8712_11 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3G2HKE7 |
Locus tag | LU654_RS21880 | Protein ID | WP_016712032.1 |
Coordinates | 4675331..4675618 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A446A2J5 |
Locus tag | LU654_RS21885 | Protein ID | WP_028700126.1 |
Coordinates | 4675608..4675847 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LU654_RS21865 (LU654_021865) | 4670370..4673249 | + | 2880 | WP_016712029.1 | ribonucleoside-diphosphate reductase subunit alpha | - |
LU654_RS21870 (LU654_021870) | 4673389..4673520 | + | 132 | WP_016712030.1 | hypothetical protein | - |
LU654_RS21875 (LU654_021875) | 4673967..4675217 | + | 1251 | WP_016712031.1 | ribonucleotide-diphosphate reductase subunit beta | - |
LU654_RS21880 (LU654_021880) | 4675331..4675618 | - | 288 | WP_016712032.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LU654_RS21885 (LU654_021885) | 4675608..4675847 | - | 240 | WP_028700126.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
LU654_RS21890 (LU654_021890) | 4676448..4677686 | + | 1239 | WP_016712034.1 | OprD family porin | - |
LU654_RS21895 (LU654_021895) | 4677850..4678656 | + | 807 | WP_016712035.1 | NAD(P)-dependent oxidoreductase | - |
LU654_RS21900 (LU654_021900) | 4678683..4679564 | + | 882 | WP_016712036.1 | SMP-30/gluconolactonase/LRE family protein | - |
LU654_RS21905 (LU654_021905) | 4679630..4680601 | + | 972 | WP_063977227.1 | TRAP transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11233.07 Da Isoelectric Point: 9.9006
>T284857 WP_016712032.1 NZ_CP128546:c4675618-4675331 [Pseudomonas monteilii]
MTYSLDFDCRALKEWKKLGDTVREQFKKKLAEVLLNPRVEANRLHSLPDCYKIKLRSSGYRLVYQVIGQEIVVFVVAVDR
RERDQAYKKAAERLE
MTYSLDFDCRALKEWKKLGDTVREQFKKKLAEVLLNPRVEANRLHSLPDCYKIKLRSSGYRLVYQVIGQEIVVFVVAVDR
RERDQAYKKAAERLE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G2HKE7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A446A2J5 |