Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4700184..4700700 | Replicon | chromosome |
| Accession | NZ_CP128545 | ||
| Organism | Pseudomonas monteilii strain NMI6266_12 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3G2HKE7 |
| Locus tag | LU662_RS22420 | Protein ID | WP_016712032.1 |
| Coordinates | 4700184..4700471 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A446A2J5 |
| Locus tag | LU662_RS22425 | Protein ID | WP_028700126.1 |
| Coordinates | 4700461..4700700 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU662_RS22405 (LU662_022405) | 4695223..4698102 | + | 2880 | WP_016712029.1 | ribonucleoside-diphosphate reductase subunit alpha | - |
| LU662_RS22410 (LU662_022410) | 4698242..4698373 | + | 132 | WP_016712030.1 | hypothetical protein | - |
| LU662_RS22415 (LU662_022415) | 4698820..4700070 | + | 1251 | WP_016712031.1 | ribonucleotide-diphosphate reductase subunit beta | - |
| LU662_RS22420 (LU662_022420) | 4700184..4700471 | - | 288 | WP_016712032.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LU662_RS22425 (LU662_022425) | 4700461..4700700 | - | 240 | WP_028700126.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| LU662_RS22430 (LU662_022430) | 4701301..4702539 | + | 1239 | WP_016712034.1 | OprD family porin | - |
| LU662_RS22435 (LU662_022435) | 4702703..4703509 | + | 807 | WP_016712035.1 | NAD(P)-dependent oxidoreductase | - |
| LU662_RS22440 (LU662_022440) | 4703536..4704417 | + | 882 | WP_016712036.1 | SMP-30/gluconolactonase/LRE family protein | - |
| LU662_RS22445 (LU662_022445) | 4704483..4705454 | + | 972 | WP_063977227.1 | TRAP transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11233.07 Da Isoelectric Point: 9.9006
>T284855 WP_016712032.1 NZ_CP128545:c4700471-4700184 [Pseudomonas monteilii]
MTYSLDFDCRALKEWKKLGDTVREQFKKKLAEVLLNPRVEANRLHSLPDCYKIKLRSSGYRLVYQVIGQEIVVFVVAVDR
RERDQAYKKAAERLE
MTYSLDFDCRALKEWKKLGDTVREQFKKKLAEVLLNPRVEANRLHSLPDCYKIKLRSSGYRLVYQVIGQEIVVFVVAVDR
RERDQAYKKAAERLE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G2HKE7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A446A2J5 |