Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3517595..3518216 | Replicon | chromosome |
| Accession | NZ_CP128545 | ||
| Organism | Pseudomonas monteilii strain NMI6266_12 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2G8MXB6 |
| Locus tag | LU662_RS16590 | Protein ID | WP_016715573.1 |
| Coordinates | 3517595..3517777 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | LU662_RS16595 | Protein ID | WP_232859993.1 |
| Coordinates | 3517815..3518216 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU662_RS16555 (LU662_016555) | 3513274..3514962 | - | 1689 | WP_081011190.1 | terminase large subunit | - |
| LU662_RS16560 (LU662_016560) | 3514959..3515504 | - | 546 | WP_060709079.1 | terminase | - |
| LU662_RS16565 (LU662_016565) | 3515664..3516002 | - | 339 | WP_232859998.1 | HNH endonuclease signature motif containing protein | - |
| LU662_RS16570 (LU662_016570) | 3516002..3516160 | - | 159 | WP_232859997.1 | hypothetical protein | - |
| LU662_RS16575 (LU662_016575) | 3516164..3516361 | - | 198 | WP_232859996.1 | hypothetical protein | - |
| LU662_RS16580 (LU662_016580) | 3516366..3516689 | - | 324 | WP_232859995.1 | phage holin, lambda family | - |
| LU662_RS16585 (LU662_016585) | 3516747..3517307 | - | 561 | WP_232859994.1 | hypothetical protein | - |
| LU662_RS16590 (LU662_016590) | 3517595..3517777 | + | 183 | WP_016715573.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LU662_RS16595 (LU662_016595) | 3517815..3518216 | + | 402 | WP_232859993.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LU662_RS16600 (LU662_016600) | 3518979..3519665 | - | 687 | WP_232859992.1 | hypothetical protein | - |
| LU662_RS16605 (LU662_016605) | 3519677..3519994 | - | 318 | WP_232859991.1 | hypothetical protein | - |
| LU662_RS16610 (LU662_016610) | 3519991..3520242 | - | 252 | WP_121784280.1 | hypothetical protein | - |
| LU662_RS16615 (LU662_016615) | 3520266..3521555 | - | 1290 | WP_232859990.1 | site-specific integrase | - |
| LU662_RS16620 (LU662_016620) | 3521552..3521980 | - | 429 | WP_232859989.1 | VRR-NUC domain-containing protein | - |
| LU662_RS16625 (LU662_016625) | 3521977..3522225 | - | 249 | WP_232859988.1 | hypothetical protein | - |
| LU662_RS16630 (LU662_016630) | 3522222..3522521 | - | 300 | WP_232859987.1 | DUF1364 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3483240..3543335 | 60095 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6696.86 Da Isoelectric Point: 11.2336
>T284854 WP_016715573.1 NZ_CP128545:3517595-3517777 [Pseudomonas monteilii]
VQSRQLIKELEAAGWVLKRVTGSHHIFKHPNNPNSIPVPHPKKDLPIGTVKSIKERAGLK
VQSRQLIKELEAAGWVLKRVTGSHHIFKHPNNPNSIPVPHPKKDLPIGTVKSIKERAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14484.33 Da Isoelectric Point: 4.2585
>AT284854 WP_232859993.1 NZ_CP128545:3517815-3518216 [Pseudomonas monteilii]
MQYPICIEWGDENTATGIQIPDIPGAVTAGDTFEEAYSSAVEVAHIMLEEIASNGQAIPMPTSAAAHRGNPDFADMGWGM
LEIDITPYLGKTEKVNVTLPGFVIQQIDRYVRDHNVKSRSSFLADAAMEKLGR
MQYPICIEWGDENTATGIQIPDIPGAVTAGDTFEEAYSSAVEVAHIMLEEIASNGQAIPMPTSAAAHRGNPDFADMGWGM
LEIDITPYLGKTEKVNVTLPGFVIQQIDRYVRDHNVKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|