Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1310643..1311264 | Replicon | chromosome |
| Accession | NZ_CP128545 | ||
| Organism | Pseudomonas monteilii strain NMI6266_12 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2G8MXB6 |
| Locus tag | LU662_RS06080 | Protein ID | WP_016715573.1 |
| Coordinates | 1311082..1311264 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | LU662_RS06075 | Protein ID | WP_232859993.1 |
| Coordinates | 1310643..1311044 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU662_RS06040 (LU662_006040) | 1305780..1306574 | + | 795 | WP_060494657.1 | ATP-binding protein | - |
| LU662_RS06045 (LU662_006045) | 1306577..1306873 | + | 297 | WP_060494656.1 | DUF1364 domain-containing protein | - |
| LU662_RS06050 (LU662_006050) | 1306870..1307298 | + | 429 | WP_232858371.1 | VRR-NUC domain-containing protein | - |
| LU662_RS06055 (LU662_006055) | 1307295..1308593 | + | 1299 | WP_060494654.1 | site-specific integrase | - |
| LU662_RS06060 (LU662_006060) | 1308617..1308868 | + | 252 | WP_121784280.1 | hypothetical protein | - |
| LU662_RS06065 (LU662_006065) | 1308865..1309182 | + | 318 | WP_232859991.1 | hypothetical protein | - |
| LU662_RS06070 (LU662_006070) | 1309194..1309880 | + | 687 | WP_232859992.1 | hypothetical protein | - |
| LU662_RS06075 (LU662_006075) | 1310643..1311044 | - | 402 | WP_232859993.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LU662_RS06080 (LU662_006080) | 1311082..1311264 | - | 183 | WP_016715573.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LU662_RS06085 (LU662_006085) | 1311552..1312112 | + | 561 | WP_232859994.1 | hypothetical protein | - |
| LU662_RS06090 (LU662_006090) | 1312170..1312493 | + | 324 | WP_232859995.1 | phage holin, lambda family | - |
| LU662_RS06095 (LU662_006095) | 1312498..1312695 | + | 198 | WP_232859996.1 | hypothetical protein | - |
| LU662_RS06100 (LU662_006100) | 1312699..1312857 | + | 159 | WP_232859997.1 | hypothetical protein | - |
| LU662_RS06105 (LU662_006105) | 1312857..1313195 | + | 339 | WP_232859998.1 | HNH endonuclease signature motif containing protein | - |
| LU662_RS06110 (LU662_006110) | 1313355..1313900 | + | 546 | WP_060709079.1 | terminase | - |
| LU662_RS06115 (LU662_006115) | 1313897..1315585 | + | 1689 | WP_081011190.1 | terminase large subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1276597..1350779 | 74182 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6696.86 Da Isoelectric Point: 11.2336
>T284853 WP_016715573.1 NZ_CP128545:c1311264-1311082 [Pseudomonas monteilii]
VQSRQLIKELEAAGWVLKRVTGSHHIFKHPNNPNSIPVPHPKKDLPIGTVKSIKERAGLK
VQSRQLIKELEAAGWVLKRVTGSHHIFKHPNNPNSIPVPHPKKDLPIGTVKSIKERAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14484.33 Da Isoelectric Point: 4.2585
>AT284853 WP_232859993.1 NZ_CP128545:c1311044-1310643 [Pseudomonas monteilii]
MQYPICIEWGDENTATGIQIPDIPGAVTAGDTFEEAYSSAVEVAHIMLEEIASNGQAIPMPTSAAAHRGNPDFADMGWGM
LEIDITPYLGKTEKVNVTLPGFVIQQIDRYVRDHNVKSRSSFLADAAMEKLGR
MQYPICIEWGDENTATGIQIPDIPGAVTAGDTFEEAYSSAVEVAHIMLEEIASNGQAIPMPTSAAAHRGNPDFADMGWGM
LEIDITPYLGKTEKVNVTLPGFVIQQIDRYVRDHNVKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|