Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 3240875..3241412 | Replicon | chromosome |
Accession | NZ_CP128544 | ||
Organism | Pseudomonas mosselii strain NMI4849_14 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2T1A3Q3 |
Locus tag | LU678_RS15595 | Protein ID | WP_017518825.1 |
Coordinates | 3240875..3241156 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2T1A3N8 |
Locus tag | LU678_RS15600 | Protein ID | WP_017518824.1 |
Coordinates | 3241143..3241412 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LU678_RS15575 (LU678_015575) | 3236344..3236469 | + | 126 | WP_269807185.1 | hypothetical protein | - |
LU678_RS15580 (LU678_015580) | 3236466..3239432 | - | 2967 | WP_143498254.1 | Tn3-like element TnAs1 family transposase | - |
LU678_RS15585 (LU678_015585) | 3239436..3239996 | - | 561 | WP_010921730.1 | recombinase family protein | - |
LU678_RS15590 (LU678_015590) | 3240173..3240748 | - | 576 | WP_001173919.1 | recombinase family protein | - |
LU678_RS15595 (LU678_015595) | 3240875..3241156 | - | 282 | WP_017518825.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
LU678_RS15600 (LU678_015600) | 3241143..3241412 | - | 270 | WP_017518824.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
LU678_RS15605 (LU678_015605) | 3241656..3242645 | - | 990 | WP_003132006.1 | DUF3330 domain-containing protein | - |
LU678_RS15610 (LU678_015610) | 3242642..3242878 | - | 237 | WP_003132004.1 | broad-spectrum mercury transporter MerE | - |
LU678_RS15615 (LU678_015615) | 3242875..3243240 | - | 366 | WP_000995360.1 | mercury resistance co-regulator MerD | - |
LU678_RS15620 (LU678_015620) | 3243258..3244943 | - | 1686 | WP_003158917.1 | mercury(II) reductase | - |
LU678_RS15625 (LU678_015625) | 3245015..3245290 | - | 276 | WP_003131987.1 | mercury resistance system periplasmic binding protein MerP | - |
LU678_RS15630 (LU678_015630) | 3245303..3245653 | - | 351 | WP_003131974.1 | mercuric ion transporter MerT | - |
LU678_RS15635 (LU678_015635) | 3245725..3246159 | + | 435 | WP_003131969.1 | mercury resistance transcriptional regulator MerR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10707.15 Da Isoelectric Point: 8.9188
>T284852 WP_017518825.1 NZ_CP128544:c3241156-3240875 [Pseudomonas mosselii]
MRTIDRSSAFKRDYKREAKGQHRATLDDALKPVLVALATDQPLDARYRDHDLSGDWAGYRECHIKPDLLLIYRKSDPDIL
RLARLGSHSELFG
MRTIDRSSAFKRDYKREAKGQHRATLDDALKPVLVALATDQPLDARYRDHDLSGDWAGYRECHIKPDLLLIYRKSDPDIL
RLARLGSHSELFG
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T1A3Q3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T1A3N8 |