Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 819304..819944 | Replicon | chromosome |
| Accession | NZ_CP128544 | ||
| Organism | Pseudomonas mosselii strain NMI4849_14 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A1H9S264 |
| Locus tag | LU678_RS03905 | Protein ID | WP_028691288.1 |
| Coordinates | 819304..819714 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A246GUY5 |
| Locus tag | LU678_RS03910 | Protein ID | WP_036986184.1 |
| Coordinates | 819714..819944 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU678_RS03880 (LU678_003880) | 816302..816727 | - | 426 | WP_028691293.1 | DUF2946 domain-containing protein | - |
| LU678_RS03885 (LU678_003885) | 816753..817235 | - | 483 | WP_028691292.1 | copper chaperone PCu(A)C | - |
| LU678_RS03890 (LU678_003890) | 817283..817672 | - | 390 | WP_028691291.1 | DUF2946 domain-containing protein | - |
| LU678_RS03895 (LU678_003895) | 817913..818767 | - | 855 | WP_028691290.1 | SPFH domain-containing protein | - |
| LU678_RS03900 (LU678_003900) | 818794..819231 | - | 438 | WP_028691289.1 | NfeD family protein | - |
| LU678_RS03905 (LU678_003905) | 819304..819714 | - | 411 | WP_028691288.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| LU678_RS03910 (LU678_003910) | 819714..819944 | - | 231 | WP_036986184.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LU678_RS03915 (LU678_003915) | 820027..820755 | - | 729 | WP_028691287.1 | cobalt-precorrin-6A reductase | - |
| LU678_RS03920 (LU678_003920) | 820752..821846 | - | 1095 | WP_028691286.1 | cobalt-precorrin-5B (C(1))-methyltransferase | - |
| LU678_RS03925 (LU678_003925) | 821839..823050 | - | 1212 | WP_028691285.1 | bifunctional cobalt-precorrin-7 (C(5))-methyltransferase/cobalt-precorrin-6B (C(15))-methyltransferase | - |
| LU678_RS03930 (LU678_003930) | 823218..824543 | + | 1326 | WP_028691284.1 | precorrin-3B synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15234.59 Da Isoelectric Point: 9.5447
>T284851 WP_028691288.1 NZ_CP128544:c819714-819304 [Pseudomonas mosselii]
MLRYMLDTNICIFTIKNKPQVVREAFNRHHGQLAISTVTLMELIYGAEKSAAPERNLAIVEGFAARLDVLDYDIQGAAHT
AQLRAELAKAGTPIGPYDRMIAGHARARGLTLVTNNLREFQRVPGLRVEDWVTHPR
MLRYMLDTNICIFTIKNKPQVVREAFNRHHGQLAISTVTLMELIYGAEKSAAPERNLAIVEGFAARLDVLDYDIQGAAHT
AQLRAELAKAGTPIGPYDRMIAGHARARGLTLVTNNLREFQRVPGLRVEDWVTHPR
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H9S264 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246GUY5 |