Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 5285533..5286173 | Replicon | chromosome |
Accession | NZ_CP128543 | ||
Organism | Pseudomonas soli strain NMI4264_15 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1H9S264 |
Locus tag | LU688_RS24405 | Protein ID | WP_028691288.1 |
Coordinates | 5285763..5286173 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | LU688_RS24400 | Protein ID | WP_094012238.1 |
Coordinates | 5285533..5285763 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LU688_RS24380 (LU688_24380) | 5280990..5282315 | - | 1326 | WP_038706878.1 | precorrin-3B synthase | - |
LU688_RS24385 (LU688_24385) | 5282427..5283638 | + | 1212 | WP_160290830.1 | precorrin-6y C5,15-methyltransferase (decarboxylating) subunit CbiE | - |
LU688_RS24390 (LU688_24390) | 5283631..5284725 | + | 1095 | WP_094012239.1 | cobalt-precorrin-5B (C(1))-methyltransferase | - |
LU688_RS24395 (LU688_24395) | 5284722..5285450 | + | 729 | WP_160290816.1 | cobalt-precorrin-6A reductase | - |
LU688_RS24400 (LU688_24400) | 5285533..5285763 | + | 231 | WP_094012238.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
LU688_RS24405 (LU688_24405) | 5285763..5286173 | + | 411 | WP_028691288.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
LU688_RS24410 (LU688_24410) | 5286246..5286683 | + | 438 | WP_088852331.1 | NfeD family protein | - |
LU688_RS24415 (LU688_24415) | 5286710..5287564 | + | 855 | WP_023631114.1 | SPFH domain-containing protein | - |
LU688_RS24420 (LU688_24420) | 5287676..5288065 | + | 390 | WP_094012237.1 | DUF2946 domain-containing protein | - |
LU688_RS24425 (LU688_24425) | 5288113..5288598 | + | 486 | WP_023631116.1 | copper chaperone PCu(A)C | - |
LU688_RS24430 (LU688_24430) | 5288619..5289044 | + | 426 | WP_023631117.1 | DUF2946 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15234.59 Da Isoelectric Point: 9.5447
>T284849 WP_028691288.1 NZ_CP128543:5285763-5286173 [Pseudomonas soli]
MLRYMLDTNICIFTIKNKPQVVREAFNRHHGQLAISTVTLMELIYGAEKSAAPERNLAIVEGFAARLDVLDYDIQGAAHT
AQLRAELAKAGTPIGPYDRMIAGHARARGLTLVTNNLREFQRVPGLRVEDWVTHPR
MLRYMLDTNICIFTIKNKPQVVREAFNRHHGQLAISTVTLMELIYGAEKSAAPERNLAIVEGFAARLDVLDYDIQGAAHT
AQLRAELAKAGTPIGPYDRMIAGHARARGLTLVTNNLREFQRVPGLRVEDWVTHPR
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|