Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 5063069..5063588 | Replicon | chromosome |
Accession | NZ_CP128543 | ||
Organism | Pseudomonas soli strain NMI4264_15 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1H9NMR5 |
Locus tag | LU688_RS23330 | Protein ID | WP_023629498.1 |
Coordinates | 5063298..5063588 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2L0LWH9 |
Locus tag | LU688_RS23325 | Protein ID | WP_023629499.1 |
Coordinates | 5063069..5063308 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LU688_RS23310 (LU688_23310) | 5058366..5058884 | - | 519 | WP_023632629.1 | histidine phosphatase family protein | - |
LU688_RS23315 (LU688_23315) | 5058949..5061252 | - | 2304 | WP_160290921.1 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase | - |
LU688_RS23320 (LU688_23320) | 5061490..5062977 | + | 1488 | WP_160290920.1 | methylenetetrahydrofolate reductase C-terminal domain-containing protein | - |
LU688_RS23325 (LU688_23325) | 5063069..5063308 | + | 240 | WP_023629499.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
LU688_RS23330 (LU688_23330) | 5063298..5063588 | + | 291 | WP_023629498.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LU688_RS23335 (LU688_23335) | 5063824..5064105 | + | 282 | WP_023629497.1 | Phd-YefM | - |
LU688_RS23340 (LU688_23340) | 5064132..5064284 | - | 153 | WP_158659585.1 | hypothetical protein | - |
LU688_RS23345 (LU688_23345) | 5064339..5065547 | - | 1209 | WP_201754976.1 | PAS domain-containing sensor histidine kinase | - |
LU688_RS23350 (LU688_23350) | 5065540..5066352 | - | 813 | WP_160290919.1 | alpha/beta hydrolase | - |
LU688_RS23355 (LU688_23355) | 5066817..5067596 | + | 780 | WP_160290918.1 | MarR family transcriptional regulator | - |
LU688_RS23360 (LU688_23360) | 5067597..5068298 | + | 702 | WP_094011755.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11378.22 Da Isoelectric Point: 10.2588
>T284848 WP_023629498.1 NZ_CP128543:5063298-5063588 [Pseudomonas soli]
MTYNLDFDARALKEWQKLGDTIRQQLKKKLATVLLNPRVEANRLHGFPDCYKIKLRSSGYRLVYQVIDHQIVVFVVAVDK
RERDQVYRKAAERLTE
MTYNLDFDARALKEWQKLGDTIRQQLKKKLATVLLNPRVEANRLHGFPDCYKIKLRSSGYRLVYQVIDHQIVVFVVAVDK
RERDQVYRKAAERLTE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H9NMR5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2L0LWH9 |