Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 4662405..4663033 | Replicon | chromosome |
| Accession | NZ_CP128543 | ||
| Organism | Pseudomonas soli strain NMI4264_15 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | LU688_RS21535 | Protein ID | WP_094012392.1 |
| Coordinates | 4662851..4663033 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A1H9TAW3 |
| Locus tag | LU688_RS21530 | Protein ID | WP_023630767.1 |
| Coordinates | 4662405..4662830 (-) | Length | 142 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU688_RS21505 (LU688_21505) | 4658042..4658536 | + | 495 | WP_094012390.1 | DUF6231 family protein | - |
| LU688_RS21510 (LU688_21510) | 4658541..4659017 | + | 477 | WP_038706657.1 | YchJ family protein | - |
| LU688_RS21515 (LU688_21515) | 4659020..4659496 | + | 477 | WP_023632502.1 | LEA type 2 family protein | - |
| LU688_RS21520 (LU688_21520) | 4659504..4659707 | + | 204 | WP_023632501.1 | SEC-C metal-binding domain-containing protein | - |
| LU688_RS21525 (LU688_21525) | 4659900..4662335 | + | 2436 | WP_160290661.1 | penicillin acylase family protein | - |
| LU688_RS21530 (LU688_21530) | 4662405..4662830 | - | 426 | WP_023630767.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LU688_RS21535 (LU688_21535) | 4662851..4663033 | - | 183 | WP_094012392.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LU688_RS21540 (LU688_21540) | 4663267..4664382 | + | 1116 | WP_094012393.1 | M14 family metallopeptidase | - |
| LU688_RS21545 (LU688_21545) | 4664389..4664631 | - | 243 | WP_046854466.1 | hypothetical protein | - |
| LU688_RS21550 (LU688_21550) | 4664729..4665295 | - | 567 | WP_023630764.1 | dCTP deaminase | - |
| LU688_RS21555 (LU688_21555) | 4665623..4665832 | + | 210 | WP_012273869.1 | cold-shock protein | - |
| LU688_RS21560 (LU688_21560) | 4665954..4667048 | - | 1095 | WP_023630763.1 | iron-sulfur cluster carrier protein ApbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6833.88 Da Isoelectric Point: 10.7459
>T284847 WP_094012392.1 NZ_CP128543:c4663033-4662851 [Pseudomonas soli]
MKYSELRRWLRSQGATFVPAKGSHFKVYLGNRQTIFPDHGAKETGEGLRKKILKDLGLSD
MKYSELRRWLRSQGATFVPAKGSHFKVYLGNRQTIFPDHGAKETGEGLRKKILKDLGLSD
Download Length: 183 bp
Antitoxin
Download Length: 142 a.a. Molecular weight: 15449.73 Da Isoelectric Point: 5.1723
>AT284847 WP_023630767.1 NZ_CP128543:c4662830-4662405 [Pseudomonas soli]
MNFDYPVNVHRDTGSVWISCPDIPEMASAGDTLDEALFDAVDALESALSLYVERRAAIPLPTPVQSAEAIVRLPALTAAK
AALWNTMVSQNVTKTEMARRLGVNRPQVDRLVDLLHRSKIEQVEHALHVLGQRIELAVVAA
MNFDYPVNVHRDTGSVWISCPDIPEMASAGDTLDEALFDAVDALESALSLYVERRAAIPLPTPVQSAEAIVRLPALTAAK
AALWNTMVSQNVTKTEMARRLGVNRPQVDRLVDLLHRSKIEQVEHALHVLGQRIELAVVAA
Download Length: 426 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|