Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 4017687..4018726 | Replicon | chromosome |
Accession | NZ_CP128542 | ||
Organism | Pseudomonas asiatica strain NMI3658_15 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | A0A2N5BP56 |
Locus tag | LU687_RS19170 | Protein ID | WP_015271072.1 |
Coordinates | 4018151..4018726 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | A0A2N5BP88 |
Locus tag | LU687_RS19165 | Protein ID | WP_015271071.1 |
Coordinates | 4017687..4018154 (+) | Length | 156 a.a. |
Genomic Context
Location: 4013751..4014770 (1020 bp)
Type: Others
Protein ID: WP_013973404.1
Type: Others
Protein ID: WP_013973404.1
Location: 4014772..4016385 (1614 bp)
Type: Others
Protein ID: WP_015271068.1
Type: Others
Protein ID: WP_015271068.1
Location: 4016843..4017085 (243 bp)
Type: Others
Protein ID: WP_015271069.1
Type: Others
Protein ID: WP_015271069.1
Location: 4017242..4017505 (264 bp)
Type: Others
Protein ID: WP_015271070.1
Type: Others
Protein ID: WP_015271070.1
Location: 4017687..4018154 (468 bp)
Type: Antitoxin
Protein ID: WP_015271071.1
Type: Antitoxin
Protein ID: WP_015271071.1
Location: 4018151..4018726 (576 bp)
Type: Toxin
Protein ID: WP_015271072.1
Type: Toxin
Protein ID: WP_015271072.1
Location: 4018941..4021871 (2931 bp)
Type: Others
Protein ID: WP_015271073.1
Type: Others
Protein ID: WP_015271073.1
Location: 4022234..4023139 (906 bp)
Type: Others
Protein ID: WP_013973410.1
Type: Others
Protein ID: WP_013973410.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LU687_RS19145 (LU687_019145) | 4013751..4014770 | + | 1020 | WP_013973404.1 | ABC transporter permease | - |
LU687_RS19150 (LU687_019150) | 4014772..4016385 | + | 1614 | WP_015271068.1 | ABC transporter ATP-binding protein | - |
LU687_RS19155 (LU687_019155) | 4016843..4017085 | + | 243 | WP_015271069.1 | hypothetical protein | - |
LU687_RS19160 (LU687_019160) | 4017242..4017505 | + | 264 | WP_015271070.1 | DUF3077 domain-containing protein | - |
LU687_RS19165 (LU687_019165) | 4017687..4018154 | + | 468 | WP_015271071.1 | helix-turn-helix domain-containing protein | Antitoxin |
LU687_RS19170 (LU687_019170) | 4018151..4018726 | + | 576 | WP_015271072.1 | PIN domain-containing protein | Toxin |
LU687_RS19175 (LU687_019175) | 4018941..4021871 | + | 2931 | WP_015271073.1 | aminotransferase | - |
LU687_RS19180 (LU687_019180) | 4022234..4023139 | + | 906 | WP_013973410.1 | LysR family transcriptional regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3996616..4021871 | 25255 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21970.23 Da Isoelectric Point: 5.0798
>T284845 WP_015271072.1 NZ_CP128542:4018151-4018726 [Pseudomonas asiatica]
MKHSPFTAIYDANVLYPAPLRDFLMNLALTGIYRARWSTKIHDEWKRNLLLNRPDLTLEQVDRTSRRMDAAVPDALVTDY
ESLVEGLDLPDKDDRHVLAAAIKCNASVIVTFNLKDFPETALDVFDIEPLHPDDFIADLWDLDKAAVLEAAQRQRMSLKN
PPHSVQQYLDRLLQQKLPESVKLLSEFKFLL
MKHSPFTAIYDANVLYPAPLRDFLMNLALTGIYRARWSTKIHDEWKRNLLLNRPDLTLEQVDRTSRRMDAAVPDALVTDY
ESLVEGLDLPDKDDRHVLAAAIKCNASVIVTFNLKDFPETALDVFDIEPLHPDDFIADLWDLDKAAVLEAAQRQRMSLKN
PPHSVQQYLDRLLQQKLPESVKLLSEFKFLL
Download Length: 576 bp
Antitoxin
Download Length: 156 a.a. Molecular weight: 17366.86 Da Isoelectric Point: 5.3408
>AT284845 WP_015271071.1 NZ_CP128542:4017687-4018154 [Pseudomonas asiatica]
MTTADLSRKMLPDEKEIAVAVESSRTLAAFLSTKSDTQRIELLNEENQRQVVEVPTFALRLFGEILSELALGNSVKVVPI
HAELTTQEAADLLNVSRPYLVKLLDESVIPHTKTGRHRRVKFSDLVAYKDKRDEVSRAAMDALAAEAQELRMGYE
MTTADLSRKMLPDEKEIAVAVESSRTLAAFLSTKSDTQRIELLNEENQRQVVEVPTFALRLFGEILSELALGNSVKVVPI
HAELTTQEAADLLNVSRPYLVKLLDESVIPHTKTGRHRRVKFSDLVAYKDKRDEVSRAAMDALAAEAQELRMGYE
Download Length: 468 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2N5BP56 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2N5BP88 |