Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2501309..2501825 | Replicon | chromosome |
Accession | NZ_CP128542 | ||
Organism | Pseudomonas asiatica strain NMI3658_15 |
Toxin (Protein)
Gene name | relE | Uniprot ID | F8G1E7 |
Locus tag | LU687_RS12235 | Protein ID | WP_003259987.1 |
Coordinates | 2501544..2501825 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | F8G1E6 |
Locus tag | LU687_RS12230 | Protein ID | WP_013972043.1 |
Coordinates | 2501309..2501554 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LU687_RS12210 (LU687_012210) | 2496721..2497200 | - | 480 | WP_015269934.1 | transposase | - |
LU687_RS12215 (LU687_012215) | 2497457..2497999 | - | 543 | WP_015269935.1 | WYL domain-containing protein | - |
LU687_RS12220 (LU687_012220) | 2498735..2499928 | + | 1194 | WP_015269936.1 | MFS transporter | - |
LU687_RS12225 (LU687_012225) | 2499959..2501065 | + | 1107 | WP_015269937.1 | alkene reductase | - |
LU687_RS12230 (LU687_012230) | 2501309..2501554 | + | 246 | WP_013972043.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
LU687_RS12235 (LU687_012235) | 2501544..2501825 | + | 282 | WP_003259987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LU687_RS12240 (LU687_012240) | 2501841..2502473 | - | 633 | WP_015269938.1 | BRCT domain-containing protein | - |
LU687_RS12245 (LU687_012245) | 2502490..2502885 | - | 396 | WP_023662326.1 | hypothetical protein | - |
LU687_RS12250 (LU687_012250) | 2502974..2503882 | - | 909 | WP_015269940.1 | LysR family transcriptional regulator | - |
LU687_RS12255 (LU687_012255) | 2504174..2505478 | + | 1305 | WP_013972046.1 | MFS transporter | - |
LU687_RS12260 (LU687_012260) | 2505509..2506750 | + | 1242 | WP_015269941.1 | Zn-dependent hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10909.78 Da Isoelectric Point: 10.7594
>T284843 WP_003259987.1 NZ_CP128542:2501544-2501825 [Pseudomonas asiatica]
MTYKLEFLPSALKEWGKLGHTVREQIKKKLAERLQSPKVQADALRDLPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRSAQKR
MTYKLEFLPSALKEWGKLGHTVREQIKKKLAERLQSPKVQADALRDLPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRSAQKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|