Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 2501309..2501825 | Replicon | chromosome |
| Accession | NZ_CP128542 | ||
| Organism | Pseudomonas asiatica strain NMI3658_15 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | F8G1E7 |
| Locus tag | LU687_RS12235 | Protein ID | WP_003259987.1 |
| Coordinates | 2501544..2501825 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | F8G1E6 |
| Locus tag | LU687_RS12230 | Protein ID | WP_013972043.1 |
| Coordinates | 2501309..2501554 (+) | Length | 82 a.a. |
Genomic Context
Location: 2498735..2499928 (1194 bp)
Type: Others
Protein ID: WP_015269936.1
Type: Others
Protein ID: WP_015269936.1
Location: 2499959..2501065 (1107 bp)
Type: Others
Protein ID: WP_015269937.1
Type: Others
Protein ID: WP_015269937.1
Location: 2501309..2501554 (246 bp)
Type: Antitoxin
Protein ID: WP_013972043.1
Type: Antitoxin
Protein ID: WP_013972043.1
Location: 2501544..2501825 (282 bp)
Type: Toxin
Protein ID: WP_003259987.1
Type: Toxin
Protein ID: WP_003259987.1
Location: 2504174..2505478 (1305 bp)
Type: Others
Protein ID: WP_013972046.1
Type: Others
Protein ID: WP_013972046.1
Location: 2505509..2506750 (1242 bp)
Type: Others
Protein ID: WP_015269941.1
Type: Others
Protein ID: WP_015269941.1
Location: 2496721..2497200 (480 bp)
Type: Others
Protein ID: WP_015269934.1
Type: Others
Protein ID: WP_015269934.1
Location: 2497457..2497999 (543 bp)
Type: Others
Protein ID: WP_015269935.1
Type: Others
Protein ID: WP_015269935.1
Location: 2501841..2502473 (633 bp)
Type: Others
Protein ID: WP_015269938.1
Type: Others
Protein ID: WP_015269938.1
Location: 2502490..2502885 (396 bp)
Type: Others
Protein ID: WP_023662326.1
Type: Others
Protein ID: WP_023662326.1
Location: 2502974..2503882 (909 bp)
Type: Others
Protein ID: WP_015269940.1
Type: Others
Protein ID: WP_015269940.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU687_RS12210 (LU687_012210) | 2496721..2497200 | - | 480 | WP_015269934.1 | transposase | - |
| LU687_RS12215 (LU687_012215) | 2497457..2497999 | - | 543 | WP_015269935.1 | WYL domain-containing protein | - |
| LU687_RS12220 (LU687_012220) | 2498735..2499928 | + | 1194 | WP_015269936.1 | MFS transporter | - |
| LU687_RS12225 (LU687_012225) | 2499959..2501065 | + | 1107 | WP_015269937.1 | alkene reductase | - |
| LU687_RS12230 (LU687_012230) | 2501309..2501554 | + | 246 | WP_013972043.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| LU687_RS12235 (LU687_012235) | 2501544..2501825 | + | 282 | WP_003259987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LU687_RS12240 (LU687_012240) | 2501841..2502473 | - | 633 | WP_015269938.1 | BRCT domain-containing protein | - |
| LU687_RS12245 (LU687_012245) | 2502490..2502885 | - | 396 | WP_023662326.1 | hypothetical protein | - |
| LU687_RS12250 (LU687_012250) | 2502974..2503882 | - | 909 | WP_015269940.1 | LysR family transcriptional regulator | - |
| LU687_RS12255 (LU687_012255) | 2504174..2505478 | + | 1305 | WP_013972046.1 | MFS transporter | - |
| LU687_RS12260 (LU687_012260) | 2505509..2506750 | + | 1242 | WP_015269941.1 | Zn-dependent hydrolase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10909.78 Da Isoelectric Point: 10.7594
>T284843 WP_003259987.1 NZ_CP128542:2501544-2501825 [Pseudomonas asiatica]
MTYKLEFLPSALKEWGKLGHTVREQIKKKLAERLQSPKVQADALRDLPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRSAQKR
MTYKLEFLPSALKEWGKLGHTVREQIKKKLAERLQSPKVQADALRDLPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRSAQKR
Download Length: 282 bp