Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 994270..994856 | Replicon | chromosome |
Accession | NZ_CP128542 | ||
Organism | Pseudomonas asiatica strain NMI3658_15 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | LU687_RS04650 | Protein ID | WP_080604915.1 |
Coordinates | 994270..994563 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A2N5BNF2 |
Locus tag | LU687_RS04655 | Protein ID | WP_061303299.1 |
Coordinates | 994560..994856 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LU687_RS04625 (LU687_004625) | 989762..990616 | + | 855 | WP_015269000.1 | putative selenate ABC transporter substrate-binding protein | - |
LU687_RS04630 (LU687_004630) | 990637..991431 | + | 795 | WP_015269001.1 | phosphonate ABC transporter ATP-binding protein | - |
LU687_RS04635 (LU687_004635) | 991425..992252 | + | 828 | WP_015269002.1 | ABC transporter permease | - |
LU687_RS04640 (LU687_004640) | 992249..993016 | + | 768 | WP_015269003.1 | phosphonate ABC transporter, permease protein PhnE | - |
LU687_RS04645 (LU687_004645) | 993156..994049 | - | 894 | WP_015269004.1 | bestrophin family ion channel | - |
LU687_RS04650 (LU687_004650) | 994270..994563 | + | 294 | WP_080604915.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LU687_RS04655 (LU687_004655) | 994560..994856 | + | 297 | WP_061303299.1 | putative addiction module antidote protein | Antitoxin |
LU687_RS04660 (LU687_004660) | 995010..995912 | - | 903 | WP_015269007.1 | transporter substrate-binding domain-containing protein | - |
LU687_RS04665 (LU687_004665) | 995940..997256 | - | 1317 | WP_223998113.1 | D-amino acid dehydrogenase | - |
LU687_RS04670 (LU687_004670) | 997319..998224 | + | 906 | WP_015269009.1 | LysR substrate-binding domain-containing protein | - |
LU687_RS04680 (LU687_004680) | 998466..999515 | + | 1050 | WP_013971008.1 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10793.69 Da Isoelectric Point: 10.5815
>T284842 WP_080604915.1 NZ_CP128542:994270-994563 [Pseudomonas asiatica]
MYLVEQTESFAVWLSSLRDLRAQLAIGRRLERAAMGNLGDVKWLGGGIGELRIDVAAGYRVYFAQKGQRLVLLLVGGDKS
TQATDILKARKLLKEMK
MYLVEQTESFAVWLSSLRDLRAQLAIGRRLERAAMGNLGDVKWLGGGIGELRIDVAAGYRVYFAQKGQRLVLLLVGGDKS
TQATDILKARKLLKEMK
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|