Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3840449..3841070 | Replicon | chromosome |
| Accession | NZ_CP128541 | ||
| Organism | Pseudomonas monteilii strain NMI135_16 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2G8MXB6 |
| Locus tag | LU690_RS18125 | Protein ID | WP_016715573.1 |
| Coordinates | 3840449..3840631 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | LU690_RS18130 | Protein ID | WP_232891382.1 |
| Coordinates | 3840669..3841070 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU690_RS18095 (LU690_18095) | 3836642..3836803 | - | 162 | WP_232891388.1 | hypothetical protein | - |
| LU690_RS18100 (LU690_18100) | 3836800..3838479 | - | 1680 | WP_232891387.1 | terminase large subunit | - |
| LU690_RS18105 (LU690_18105) | 3838483..3838959 | - | 477 | WP_232891386.1 | terminase small subunit | - |
| LU690_RS18110 (LU690_18110) | 3839151..3839489 | - | 339 | WP_232891385.1 | HNH endonuclease signature motif containing protein | - |
| LU690_RS18115 (LU690_18115) | 3839489..3839677 | - | 189 | WP_232891384.1 | hypothetical protein | - |
| LU690_RS18120 (LU690_18120) | 3839738..3840061 | - | 324 | WP_232891383.1 | phage holin, lambda family | - |
| LU690_RS18125 (LU690_18125) | 3840449..3840631 | + | 183 | WP_016715573.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LU690_RS18130 (LU690_18130) | 3840669..3841070 | + | 402 | WP_232891382.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LU690_RS18135 (LU690_18135) | 3841117..3841671 | - | 555 | WP_232891381.1 | hypothetical protein | - |
| LU690_RS18140 (LU690_18140) | 3841825..3842214 | - | 390 | WP_019471606.1 | antiterminator Q family protein | - |
| LU690_RS18145 (LU690_18145) | 3842226..3842543 | - | 318 | WP_232891380.1 | hypothetical protein | - |
| LU690_RS18150 (LU690_18150) | 3842719..3844017 | - | 1299 | WP_232891379.1 | site-specific integrase | - |
| LU690_RS18155 (LU690_18155) | 3844014..3844442 | - | 429 | WP_232891378.1 | VRR-NUC domain-containing protein | - |
| LU690_RS18160 (LU690_18160) | 3844439..3844735 | - | 297 | WP_232891377.1 | DUF1364 domain-containing protein | - |
| LU690_RS18165 (LU690_18165) | 3844738..3845547 | - | 810 | WP_232891376.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3805337..3862772 | 57435 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6696.86 Da Isoelectric Point: 11.2336
>T284839 WP_016715573.1 NZ_CP128541:3840449-3840631 [Pseudomonas monteilii]
VQSRQLIKELEAAGWVLKRVTGSHHIFKHPNNPNSIPVPHPKKDLPIGTVKSIKERAGLK
VQSRQLIKELEAAGWVLKRVTGSHHIFKHPNNPNSIPVPHPKKDLPIGTVKSIKERAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14542.37 Da Isoelectric Point: 4.1955
>AT284839 WP_232891382.1 NZ_CP128541:3840669-3841070 [Pseudomonas monteilii]
MQYPICIEWGDENTATGIQIPDIPGAVTAGDTFEEAYTSAVEVAHIMLEEIASNGQDIPMPTSAAAHRGNPDFADMGWGM
LEIDITPYLGKTEKVNVTLPGFVIQQIDRYVRDHNVKSRSSFLADAAMEKLGR
MQYPICIEWGDENTATGIQIPDIPGAVTAGDTFEEAYTSAVEVAHIMLEEIASNGQDIPMPTSAAAHRGNPDFADMGWGM
LEIDITPYLGKTEKVNVTLPGFVIQQIDRYVRDHNVKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|