Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3614270..3614891 | Replicon | chromosome |
| Accession | NZ_CP128541 | ||
| Organism | Pseudomonas monteilii strain NMI135_16 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2G8MXB6 |
| Locus tag | LU690_RS16765 | Protein ID | WP_016715573.1 |
| Coordinates | 3614270..3614452 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | LU690_RS16770 | Protein ID | WP_232859993.1 |
| Coordinates | 3614490..3614891 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU690_RS16725 (LU690_16725) | 3609791..3609952 | - | 162 | WP_177331322.1 | hypothetical protein | - |
| LU690_RS16730 (LU690_16730) | 3609949..3611637 | - | 1689 | WP_232891453.1 | terminase large subunit | - |
| LU690_RS16735 (LU690_16735) | 3611634..3612179 | - | 546 | WP_232891452.1 | terminase small subunit | - |
| LU690_RS16740 (LU690_16740) | 3612339..3612677 | - | 339 | WP_232859998.1 | HNH endonuclease signature motif containing protein | - |
| LU690_RS16745 (LU690_16745) | 3612677..3612835 | - | 159 | WP_232859997.1 | hypothetical protein | - |
| LU690_RS16750 (LU690_16750) | 3612839..3613036 | - | 198 | WP_232859996.1 | hypothetical protein | - |
| LU690_RS16755 (LU690_16755) | 3613041..3613364 | - | 324 | WP_232859995.1 | phage holin, lambda family | - |
| LU690_RS16760 (LU690_16760) | 3613422..3613982 | - | 561 | WP_232891451.1 | hypothetical protein | - |
| LU690_RS16765 (LU690_16765) | 3614270..3614452 | + | 183 | WP_016715573.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LU690_RS16770 (LU690_16770) | 3614490..3614891 | + | 402 | WP_232859993.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LU690_RS16775 (LU690_16775) | 3615654..3616340 | - | 687 | WP_232859992.1 | hypothetical protein | - |
| LU690_RS16780 (LU690_16780) | 3616352..3616669 | - | 318 | WP_232859991.1 | hypothetical protein | - |
| LU690_RS16785 (LU690_16785) | 3616666..3616917 | - | 252 | WP_121784280.1 | hypothetical protein | - |
| LU690_RS16790 (LU690_16790) | 3616941..3618230 | - | 1290 | WP_232891450.1 | site-specific integrase | - |
| LU690_RS16795 (LU690_16795) | 3618227..3618640 | - | 414 | WP_232862374.1 | VRR-NUC domain-containing protein | - |
| LU690_RS16800 (LU690_16800) | 3618652..3618900 | - | 249 | WP_232859988.1 | hypothetical protein | - |
| LU690_RS16805 (LU690_16805) | 3618897..3619196 | - | 300 | WP_232859987.1 | DUF1364 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6696.86 Da Isoelectric Point: 11.2336
>T284838 WP_016715573.1 NZ_CP128541:3614270-3614452 [Pseudomonas monteilii]
VQSRQLIKELEAAGWVLKRVTGSHHIFKHPNNPNSIPVPHPKKDLPIGTVKSIKERAGLK
VQSRQLIKELEAAGWVLKRVTGSHHIFKHPNNPNSIPVPHPKKDLPIGTVKSIKERAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14484.33 Da Isoelectric Point: 4.2585
>AT284838 WP_232859993.1 NZ_CP128541:3614490-3614891 [Pseudomonas monteilii]
MQYPICIEWGDENTATGIQIPDIPGAVTAGDTFEEAYSSAVEVAHIMLEEIASNGQAIPMPTSAAAHRGNPDFADMGWGM
LEIDITPYLGKTEKVNVTLPGFVIQQIDRYVRDHNVKSRSSFLADAAMEKLGR
MQYPICIEWGDENTATGIQIPDIPGAVTAGDTFEEAYSSAVEVAHIMLEEIASNGQAIPMPTSAAAHRGNPDFADMGWGM
LEIDITPYLGKTEKVNVTLPGFVIQQIDRYVRDHNVKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|