Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 246593..247182 | Replicon | chromosome |
Accession | NZ_CP128532 | ||
Organism | Mannheimia haemolytica strain 90826 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A248ZY19 |
Locus tag | QTV57_RS01265 | Protein ID | WP_006248516.1 |
Coordinates | 246593..246925 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A248ZX26 |
Locus tag | QTV57_RS01270 | Protein ID | WP_006248517.1 |
Coordinates | 246922..247182 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTV57_RS01225 | 241788..242408 | - | 621 | WP_289394681.1 | dTMP kinase | - |
QTV57_RS01230 | 242419..243453 | - | 1035 | WP_006248509.1 | endolytic transglycosylase MltG | - |
QTV57_RS01250 | 244033..244560 | + | 528 | WP_006248512.1 | inorganic diphosphatase | - |
QTV57_RS01255 | 244616..245371 | + | 756 | WP_006248513.1 | M48 family metallopeptidase | - |
QTV57_RS01260 | 245435..246466 | - | 1032 | WP_006248514.1 | tryptophan--tRNA ligase | - |
QTV57_RS01265 | 246593..246925 | - | 333 | WP_006248516.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QTV57_RS01270 | 246922..247182 | - | 261 | WP_006248517.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QTV57_RS01275 | 247252..247920 | - | 669 | WP_006248518.1 | phosphoglycolate phosphatase | - |
QTV57_RS01280 | 248007..248804 | - | 798 | WP_006248519.1 | prolipoprotein diacylglyceryl transferase | - |
QTV57_RS01285 | 248812..249600 | - | 789 | WP_006248520.1 | sulfite exporter TauE/SafE family protein | - |
QTV57_RS01290 | 249602..250246 | - | 645 | WP_006248521.1 | RNA pyrophosphohydrolase | - |
QTV57_RS01295 | 250858..252003 | + | 1146 | WP_006248526.1 | FMN-dependent L-lactate dehydrogenase LldD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12007.94 Da Isoelectric Point: 6.4597
>T284824 WP_006248516.1 NZ_CP128532:c246925-246593 [Mannheimia haemolytica]
MKRGDIYWLDLDPTLGHEQSGFRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLKDAGLKTTGIIRCDQPRTV
DIAQRHGKFIEALPESLLDEIMARVSVIFE
MKRGDIYWLDLDPTLGHEQSGFRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLKDAGLKTTGIIRCDQPRTV
DIAQRHGKFIEALPESLLDEIMARVSVIFE
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A248ZY19 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A248ZX26 |