Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-MazE |
| Location | 2081511..2082161 | Replicon | chromosome |
| Accession | NZ_CP128531 | ||
| Organism | Mannheimia haemolytica strain 120731 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A547EDJ6 |
| Locus tag | QTV67_RS10650 | Protein ID | WP_006249411.1 |
| Coordinates | 2081511..2081900 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A1D2Q6P1 |
| Locus tag | QTV67_RS10655 | Protein ID | WP_006251766.1 |
| Coordinates | 2081901..2082161 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV67_RS10605 | 2076991..2077800 | - | 810 | WP_006250123.1 | metal ABC transporter permease | - |
| QTV67_RS10610 | 2077793..2078653 | - | 861 | WP_061887112.1 | metal ABC transporter permease | - |
| QTV67_RS10615 | 2078727..2079512 | - | 786 | WP_061887113.1 | GDP-L-fucose synthase | - |
| QTV67_RS10645 | 2080253..2081491 | - | 1239 | WP_006251767.1 | peptidase T | - |
| QTV67_RS10650 | 2081511..2081900 | - | 390 | WP_006249411.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QTV67_RS10655 | 2081901..2082161 | - | 261 | WP_006251766.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QTV67_RS10660 | 2082277..2082489 | - | 213 | WP_006251765.1 | BrnA antitoxin family protein | - |
| QTV67_RS10665 | 2082490..2082777 | - | 288 | WP_006251764.1 | BrnT family toxin | - |
| QTV67_RS10670 | 2082940..2086473 | - | 3534 | WP_006251763.1 | transcription-repair coupling factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14633.91 Da Isoelectric Point: 7.1041
>T284822 WP_006249411.1 NZ_CP128531:c2081900-2081511 [Mannheimia haemolytica]
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A547EDJ6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1D2Q6P1 |