Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 1307502..1308150 | Replicon | chromosome |
| Accession | NZ_CP128531 | ||
| Organism | Mannheimia haemolytica strain 120731 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A249A099 |
| Locus tag | QTV67_RS06655 | Protein ID | WP_006251221.1 |
| Coordinates | 1307502..1307678 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A248ZZL6 |
| Locus tag | QTV67_RS06660 | Protein ID | WP_006251222.1 |
| Coordinates | 1307734..1308150 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV67_RS06630 | 1302815..1305310 | - | 2496 | WP_061888644.1 | phage tail length tape measure family protein | - |
| QTV67_RS06635 | 1305397..1305792 | - | 396 | WP_006251217.1 | hypothetical protein | - |
| QTV67_RS06640 | 1305860..1306318 | - | 459 | WP_006251218.1 | hypothetical protein | - |
| QTV67_RS06645 | 1306487..1306720 | + | 234 | WP_020824316.1 | hypothetical protein | - |
| QTV67_RS06650 | 1306735..1307400 | - | 666 | WP_015587050.1 | DUF6246 family protein | - |
| QTV67_RS06655 | 1307502..1307678 | + | 177 | WP_006251221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QTV67_RS06660 | 1307734..1308150 | + | 417 | WP_006251222.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QTV67_RS06665 | 1308190..1308672 | - | 483 | WP_006251223.1 | phage tail tube protein | - |
| QTV67_RS06670 | 1308676..1309056 | - | 381 | WP_006251224.1 | hypothetical protein | - |
| QTV67_RS06675 | 1309053..1309421 | - | 369 | WP_006251225.1 | hypothetical protein | - |
| QTV67_RS06680 | 1309423..1309767 | - | 345 | WP_006251226.1 | hypothetical protein | - |
| QTV67_RS06685 | 1309767..1310144 | - | 378 | WP_006251227.1 | hypothetical protein | - |
| QTV67_RS06690 | 1310147..1310407 | - | 261 | WP_020824317.1 | hypothetical protein | - |
| QTV67_RS06695 | 1310419..1311405 | - | 987 | WP_062627922.1 | encapsulin | - |
| QTV67_RS06700 | 1311420..1311854 | - | 435 | WP_006251230.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1292000..1347638 | 55638 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6640.79 Da Isoelectric Point: 10.7708
>T284820 WP_006251221.1 NZ_CP128531:1307502-1307678 [Mannheimia haemolytica]
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15519.91 Da Isoelectric Point: 4.3508
>AT284820 WP_006251222.1 NZ_CP128531:1307734-1308150 [Mannheimia haemolytica]
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A099 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A248ZZL6 |