Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /BrnT(toxin) |
| Location | 641177..641699 | Replicon | chromosome |
| Accession | NZ_CP128531 | ||
| Organism | Mannheimia haemolytica strain 120731 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A249A107 |
| Locus tag | QTV67_RS03265 | Protein ID | WP_006249269.1 |
| Coordinates | 641177..641473 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A249A190 |
| Locus tag | QTV67_RS03270 | Protein ID | WP_006249270.1 |
| Coordinates | 641457..641699 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV67_RS03250 | 636231..637556 | + | 1326 | WP_020831251.1 | anti-phage deoxyguanosine triphosphatase | - |
| QTV67_RS03255 | 637677..637976 | + | 300 | WP_006249265.1 | hypothetical protein | - |
| QTV67_RS03260 | 638138..641050 | + | 2913 | WP_006249267.1 | RNA polymerase-associated protein RapA | - |
| QTV67_RS03265 | 641177..641473 | + | 297 | WP_006249269.1 | BrnT family toxin | Toxin |
| QTV67_RS03270 | 641457..641699 | + | 243 | WP_006249270.1 | CopG family antitoxin | Antitoxin |
| QTV67_RS03275 | 641711..642379 | + | 669 | WP_006249271.1 | bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA | - |
| QTV67_RS03280 | 642357..642932 | - | 576 | WP_006249272.1 | 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD | - |
| QTV67_RS03285 | 642992..643834 | + | 843 | WP_006250575.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
| QTV67_RS03290 | 644012..645067 | - | 1056 | WP_006251368.1 | tyrosine-type recombinase/integrase | - |
| QTV67_RS03295 | 645027..645302 | - | 276 | WP_006248810.1 | DUF4224 domain-containing protein | - |
| QTV67_RS03300 | 645329..645820 | - | 492 | WP_021279670.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 12009.89 Da Isoelectric Point: 7.9454
>T284819 WP_006249269.1 NZ_CP128531:641177-641473 [Mannheimia haemolytica]
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A107 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A190 |