Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-YefM |
| Location | 22324..23039 | Replicon | chromosome |
| Accession | NZ_CP128531 | ||
| Organism | Mannheimia haemolytica strain 120731 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QTV67_RS00095 | Protein ID | WP_006250491.1 |
| Coordinates | 22324..22752 (-) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A248ZW87 |
| Locus tag | QTV67_RS00100 | Protein ID | WP_006248272.1 |
| Coordinates | 22752..23039 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV67_RS00080 | 17579..19231 | + | 1653 | WP_040080487.1 | phospho-sugar mutase | - |
| QTV67_RS00085 | 19284..20217 | + | 934 | Protein_16 | nucleoside hydrolase | - |
| QTV67_RS00090 | 20239..22320 | - | 2082 | WP_040080489.1 | ATP-dependent DNA helicase RecG | - |
| QTV67_RS00095 | 22324..22752 | - | 429 | WP_006250491.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QTV67_RS00100 | 22752..23039 | - | 288 | WP_006248272.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| QTV67_RS00105 | 23203..25086 | + | 1884 | WP_040080490.1 | molecular chaperone HtpG | - |
| QTV67_RS00110 | 25175..25321 | + | 147 | WP_230269068.1 | hypothetical protein | - |
| QTV67_RS00115 | 25466..26506 | + | 1041 | WP_021265350.1 | IS481 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 25466..26506 | 1040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 16640.06 Da Isoelectric Point: 8.9269
>T284816 WP_006250491.1 NZ_CP128531:c22752-22324 [Mannheimia haemolytica]
MYRYLFDTNIVSELYKLRNDKMDVNVRQWLRGVNPSQTNISCITLSEIKTGILLKARKDKEQSDRLNDWFENNVLKAYQT
KAFVVNNDIALLASEYHIPNKMDLNDAYIAATAKYHNLILVTRNTKDFIRCDVRLFNPFETA
MYRYLFDTNIVSELYKLRNDKMDVNVRQWLRGVNPSQTNISCITLSEIKTGILLKARKDKEQSDRLNDWFENNVLKAYQT
KAFVVNNDIALLASEYHIPNKMDLNDAYIAATAKYHNLILVTRNTKDFIRCDVRLFNPFETA
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|