Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-MazE |
Location | 2157739..2158389 | Replicon | chromosome |
Accession | NZ_CP128530 | ||
Organism | Mannheimia haemolytica strain 131633 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A547EDJ6 |
Locus tag | QTV58_RS11025 | Protein ID | WP_006249411.1 |
Coordinates | 2157739..2158128 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1D2Q6P1 |
Locus tag | QTV58_RS11030 | Protein ID | WP_006251766.1 |
Coordinates | 2158129..2158389 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTV58_RS10980 | 2153219..2154028 | - | 810 | WP_006250123.1 | metal ABC transporter permease | - |
QTV58_RS10985 | 2154021..2154881 | - | 861 | WP_061887112.1 | metal ABC transporter permease | - |
QTV58_RS10990 | 2154955..2155740 | - | 786 | WP_061887113.1 | GDP-L-fucose synthase | - |
QTV58_RS11020 | 2156481..2157719 | - | 1239 | WP_006251767.1 | peptidase T | - |
QTV58_RS11025 | 2157739..2158128 | - | 390 | WP_006249411.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QTV58_RS11030 | 2158129..2158389 | - | 261 | WP_006251766.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QTV58_RS11035 | 2158505..2158717 | - | 213 | WP_006251765.1 | BrnA antitoxin family protein | - |
QTV58_RS11040 | 2158718..2159005 | - | 288 | WP_006251764.1 | BrnT family toxin | - |
QTV58_RS11045 | 2159168..2162701 | - | 3534 | WP_006251763.1 | transcription-repair coupling factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14633.91 Da Isoelectric Point: 7.1041
>T284815 WP_006249411.1 NZ_CP128530:c2158128-2157739 [Mannheimia haemolytica]
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A547EDJ6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D2Q6P1 |