284805

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 1519548..1520087 Replicon chromosome
Accession NZ_CP128529
Organism Mannheimia haemolytica strain 132077

Toxin (Protein)


Gene name relE Uniprot ID A0A248ZYA9
Locus tag QTV53_RS07955 Protein ID WP_006247804.1
Coordinates 1519818..1520087 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A547E920
Locus tag QTV53_RS07950 Protein ID WP_006247803.1
Coordinates 1519548..1519814 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTV53_RS07900 1514948..1515583 - 636 Protein_1539 helix-turn-helix domain-containing protein -
QTV53_RS07905 1515684..1516394 - 711 Protein_1540 site-specific integrase -
QTV53_RS07910 1516298..1516621 - 324 WP_006253316.1 helix-turn-helix domain-containing protein -
QTV53_RS07915 1516702..1516869 - 168 WP_006253314.1 DNA cytosine methyltransferase -
QTV53_RS07920 1516877..1517251 - 375 WP_006247798.1 hypothetical protein -
QTV53_RS07925 1517401..1517628 + 228 Protein_1544 phage terminase large subunit family protein -
QTV53_RS07930 1517653..1518048 + 396 WP_006247799.1 phage tail terminator protein -
QTV53_RS07935 1518080..1518721 + 642 WP_006247800.1 hypothetical protein -
QTV53_RS07940 1518804..1519205 + 402 WP_006247801.1 hypothetical protein -
QTV53_RS07945 1519250..1519480 + 231 WP_006247802.1 DUF4035 domain-containing protein -
QTV53_RS07950 1519548..1519814 + 267 WP_006247803.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QTV53_RS07955 1519818..1520087 + 270 WP_006247804.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
QTV53_RS07960 1520162..1520425 + 264 WP_006247805.1 hypothetical protein -
QTV53_RS07965 1520485..1521195 + 711 WP_006253312.1 tape measure protein -
QTV53_RS07970 1521173..1521463 + 291 Protein_1553 NlpC/P60 family protein -
QTV53_RS07975 1521453..1522172 + 720 WP_006247806.1 preprotein translocase subunit YajC -
QTV53_RS07980 1522394..1523020 + 627 WP_006247807.1 tail assembly protein -
QTV53_RS07985 1523069..1523680 + 612 WP_006253310.1 hypothetical protein -
QTV53_RS07990 1523791..1524477 + 687 WP_006247808.1 hypothetical protein -
QTV53_RS07995 1524487..1524645 + 159 WP_006247809.1 hypothetical protein -
QTV53_RS08000 1524654..1524953 - 300 WP_006247810.1 XRE family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1505641..1527428 21787
- flank IS/Tn - - 1514891..1515583 692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-75)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10278.90 Da        Isoelectric Point: 6.2121

>T284805 WP_006247804.1 NZ_CP128529:1519818-1520087 [Mannheimia haemolytica]
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG

Download         Length: 270 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9913.38 Da        Isoelectric Point: 7.0082

>AT284805 WP_006247803.1 NZ_CP128529:1519548-1519814 [Mannheimia haemolytica]
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A248ZYA9

Antitoxin

Source ID Structure
AlphaFold DB A0A547E920

References