Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /BrnT(toxin) |
| Location | 470634..471156 | Replicon | chromosome |
| Accession | NZ_CP128529 | ||
| Organism | Mannheimia haemolytica strain 132077 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A249A107 |
| Locus tag | QTV53_RS02390 | Protein ID | WP_006249269.1 |
| Coordinates | 470634..470930 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A249A190 |
| Locus tag | QTV53_RS02395 | Protein ID | WP_006249270.1 |
| Coordinates | 470914..471156 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV53_RS02375 | 465689..467014 | + | 1326 | WP_006249264.1 | anti-phage deoxyguanosine triphosphatase | - |
| QTV53_RS02380 | 467135..467434 | + | 300 | WP_006249265.1 | hypothetical protein | - |
| QTV53_RS02385 | 467595..470507 | + | 2913 | WP_006249267.1 | RNA polymerase-associated protein RapA | - |
| QTV53_RS02390 | 470634..470930 | + | 297 | WP_006249269.1 | BrnT family toxin | Toxin |
| QTV53_RS02395 | 470914..471156 | + | 243 | WP_006249270.1 | CopG family antitoxin | Antitoxin |
| QTV53_RS02400 | 471168..471836 | + | 669 | WP_006249271.1 | bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA | - |
| QTV53_RS02405 | 471814..472389 | - | 576 | WP_006249272.1 | 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD | - |
| QTV53_RS02410 | 472449..473291 | + | 843 | WP_006249273.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
| QTV53_RS02415 | 473414..474055 | + | 642 | WP_006249274.1 | orotate phosphoribosyltransferase | - |
| QTV53_RS02420 | 474229..475318 | + | 1090 | Protein_459 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | htrB | 336578..491885 | 155307 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 12009.89 Da Isoelectric Point: 7.9454
>T284802 WP_006249269.1 NZ_CP128529:470634-470930 [Mannheimia haemolytica]
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A107 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A190 |