Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 1614294..1614833 Replicon chromosome
Accession NZ_CP128528
Organism Mannheimia haemolytica strain 142101

Toxin (Protein)


Gene name relE Uniprot ID A0A248ZYA9
Locus tag QTV64_RS08450 Protein ID WP_006247804.1
Coordinates 1614564..1614833 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A547E920
Locus tag QTV64_RS08445 Protein ID WP_006247803.1
Coordinates 1614294..1614560 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTV64_RS08395 1609694..1610329 - 636 Protein_1627 helix-turn-helix domain-containing protein -
QTV64_RS08400 1610430..1611140 - 711 Protein_1628 site-specific integrase -
QTV64_RS08405 1611044..1611367 - 324 WP_006253316.1 helix-turn-helix domain-containing protein -
QTV64_RS08410 1611448..1611615 - 168 WP_006253314.1 DNA cytosine methyltransferase -
QTV64_RS08415 1611623..1611997 - 375 WP_006247798.1 hypothetical protein -
QTV64_RS08420 1612147..1612374 + 228 Protein_1632 phage terminase large subunit family protein -
QTV64_RS08425 1612399..1612794 + 396 WP_006247799.1 phage tail terminator protein -
QTV64_RS08430 1612826..1613467 + 642 WP_006247800.1 hypothetical protein -
QTV64_RS08435 1613550..1613951 + 402 WP_006247801.1 hypothetical protein -
QTV64_RS08440 1613996..1614226 + 231 WP_006247802.1 DUF4035 domain-containing protein -
QTV64_RS08445 1614294..1614560 + 267 WP_006247803.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QTV64_RS08450 1614564..1614833 + 270 WP_006247804.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
QTV64_RS08455 1614908..1615171 + 264 WP_006247805.1 hypothetical protein -
QTV64_RS08460 1615231..1615941 + 711 WP_006253312.1 tape measure protein -
QTV64_RS08465 1615919..1616209 + 291 Protein_1641 NlpC/P60 family protein -
QTV64_RS08470 1616199..1616918 + 720 WP_006247806.1 preprotein translocase subunit YajC -
QTV64_RS08475 1617140..1617766 + 627 WP_006247807.1 tail assembly protein -
QTV64_RS08480 1617815..1618426 + 612 WP_006253310.1 hypothetical protein -
QTV64_RS08485 1618537..1619223 + 687 WP_006247808.1 hypothetical protein -
QTV64_RS08490 1619233..1619391 + 159 WP_006247809.1 hypothetical protein -
QTV64_RS08495 1619400..1619699 - 300 WP_006247810.1 XRE family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1601681..1625887 24206
- flank IS/Tn - - 1609637..1610329 692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-75)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10278.90 Da        Isoelectric Point: 6.2121

>T284796 WP_006247804.1 NZ_CP128528:1614564-1614833 [Mannheimia haemolytica]
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG

Download         Length: 270 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9913.38 Da        Isoelectric Point: 7.0082

>AT284796 WP_006247803.1 NZ_CP128528:1614294-1614560 [Mannheimia haemolytica]
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A248ZYA9

Antitoxin

Source ID Structure
AlphaFold DB A0A547E920

References