Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 1192971..1193619 | Replicon | chromosome |
| Accession | NZ_CP128528 | ||
| Organism | Mannheimia haemolytica strain 142101 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A249A099 |
| Locus tag | QTV64_RS06040 | Protein ID | WP_006251221.1 |
| Coordinates | 1192971..1193147 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A248ZZL6 |
| Locus tag | QTV64_RS06045 | Protein ID | WP_006251222.1 |
| Coordinates | 1193203..1193619 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV64_RS06020 | 1188289..1190784 | - | 2496 | WP_006251216.1 | phage tail length tape measure family protein | - |
| QTV64_RS06025 | 1191329..1191787 | - | 459 | WP_006251218.1 | hypothetical protein | - |
| QTV64_RS06030 | 1191956..1192189 | + | 234 | WP_020824316.1 | hypothetical protein | - |
| QTV64_RS06035 | 1192204..1192869 | - | 666 | WP_015587050.1 | DUF6246 family protein | - |
| QTV64_RS06040 | 1192971..1193147 | + | 177 | WP_006251221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QTV64_RS06045 | 1193203..1193619 | + | 417 | WP_006251222.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QTV64_RS06050 | 1193659..1194141 | - | 483 | WP_006251223.1 | phage tail tube protein | - |
| QTV64_RS06055 | 1194145..1194525 | - | 381 | WP_006251224.1 | hypothetical protein | - |
| QTV64_RS06060 | 1194522..1194890 | - | 369 | WP_006251225.1 | hypothetical protein | - |
| QTV64_RS06065 | 1194892..1195236 | - | 345 | WP_006251226.1 | hypothetical protein | - |
| QTV64_RS06070 | 1195236..1195613 | - | 378 | WP_006251227.1 | hypothetical protein | - |
| QTV64_RS06075 | 1195616..1195903 | - | 288 | WP_186806282.1 | hypothetical protein | - |
| QTV64_RS06080 | 1195915..1196904 | - | 990 | WP_006251229.1 | encapsulin | - |
| QTV64_RS06085 | 1196919..1197353 | - | 435 | WP_006251230.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1175881..1224847 | 48966 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6640.79 Da Isoelectric Point: 10.7708
>T284795 WP_006251221.1 NZ_CP128528:1192971-1193147 [Mannheimia haemolytica]
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15519.91 Da Isoelectric Point: 4.3508
>AT284795 WP_006251222.1 NZ_CP128528:1193203-1193619 [Mannheimia haemolytica]
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A099 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A248ZZL6 |