Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 876055..876695 | Replicon | chromosome |
| Accession | NZ_CP128528 | ||
| Organism | Mannheimia haemolytica strain 142101 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A378NFX7 |
| Locus tag | QTV64_RS04515 | Protein ID | WP_006250075.1 |
| Coordinates | 876513..876695 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A378NFW9 |
| Locus tag | QTV64_RS04510 | Protein ID | WP_006250074.1 |
| Coordinates | 876055..876474 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV64_RS04490 | 871602..872408 | + | 807 | WP_006248821.1 | tryptophan synthase subunit alpha | - |
| QTV64_RS04495 | 872458..873864 | + | 1407 | WP_006253513.1 | YdgA family protein | - |
| QTV64_RS04500 | 873931..874937 | - | 1007 | Protein_863 | IS481 family transposase | - |
| QTV64_RS04505 | 875075..875719 | - | 645 | WP_006253274.1 | tyrosine-type recombinase/integrase | - |
| QTV64_RS04510 | 876055..876474 | - | 420 | WP_006250074.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QTV64_RS04515 | 876513..876695 | - | 183 | WP_006250075.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QTV64_RS04520 | 876827..877324 | - | 498 | WP_006250077.1 | hypothetical protein | - |
| QTV64_RS04525 | 877317..877697 | - | 381 | WP_006248823.1 | hypothetical protein | - |
| QTV64_RS04530 | 877772..878455 | - | 684 | WP_006248824.1 | S24 family peptidase | - |
| QTV64_RS04535 | 878586..878786 | + | 201 | WP_006248825.1 | YdaS family helix-turn-helix protein | - |
| QTV64_RS04540 | 878807..879874 | + | 1068 | WP_006253284.1 | hypothetical protein | - |
| QTV64_RS04545 | 879884..880042 | + | 159 | WP_006247809.1 | hypothetical protein | - |
| QTV64_RS04550 | 880102..881142 | - | 1041 | WP_015587043.1 | IS481 family transposase | - |
| QTV64_RS04555 | 881259..881558 | - | 300 | WP_006247810.1 | XRE family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 818090..885499 | 67409 | |
| - | flank | IS/Tn | - | - | 880102..881142 | 1040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6933.03 Da Isoelectric Point: 10.3446
>T284794 WP_006250075.1 NZ_CP128528:c876695-876513 [Mannheimia haemolytica]
MKYSEFLRYLLAQGCEIENHRRGSHRKVTLNGKQSVFPYHGSKEIGTGLVNKIKKDLDLK
MKYSEFLRYLLAQGCEIENHRRGSHRKVTLNGKQSVFPYHGSKEIGTGLVNKIKKDLDLK
Download Length: 183 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15938.30 Da Isoelectric Point: 4.6963
>AT284794 WP_006250074.1 NZ_CP128528:c876474-876055 [Mannheimia haemolytica]
MLRYPVEITPDDNGTYLVTCPDIPEMASVGEDLEEALLEAQDGLATALEFYFDDRREIPMPSPIKEGQHTVNLTVLQSMK
VFLLNEMIKQGVRKAEMARRLDVHLPQIDRLLDFNHSTKVEFVEKAYGKLNQHFTILPH
MLRYPVEITPDDNGTYLVTCPDIPEMASVGEDLEEALLEAQDGLATALEFYFDDRREIPMPSPIKEGQHTVNLTVLQSMK
VFLLNEMIKQGVRKAEMARRLDVHLPQIDRLLDFNHSTKVEFVEKAYGKLNQHFTILPH
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378NFX7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378NFW9 |