Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-MazE |
| Location | 272521..273171 | Replicon | chromosome |
| Accession | NZ_CP128528 | ||
| Organism | Mannheimia haemolytica strain 142101 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A547EDJ6 |
| Locus tag | QTV64_RS01360 | Protein ID | WP_006249411.1 |
| Coordinates | 272782..273171 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A547EDM1 |
| Locus tag | QTV64_RS01355 | Protein ID | WP_006249412.1 |
| Coordinates | 272521..272781 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV64_RS01340 | 268209..271742 | + | 3534 | WP_006253629.1 | transcription-repair coupling factor | - |
| QTV64_RS01345 | 271905..272192 | + | 288 | WP_006251764.1 | BrnT family toxin | - |
| QTV64_RS01350 | 272193..272405 | + | 213 | WP_006251765.1 | BrnA antitoxin family protein | - |
| QTV64_RS01355 | 272521..272781 | + | 261 | WP_006249412.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QTV64_RS01360 | 272782..273171 | + | 390 | WP_006249411.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QTV64_RS01365 | 273191..274429 | + | 1239 | WP_006253630.1 | peptidase T | - |
| QTV64_RS01405 | 275379..276164 | + | 786 | WP_006251768.1 | hypothetical protein | - |
| QTV64_RS01410 | 276238..277098 | + | 861 | WP_006250124.1 | metal ABC transporter permease | - |
| QTV64_RS01415 | 277091..277900 | + | 810 | WP_006250123.1 | metal ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14633.91 Da Isoelectric Point: 7.1041
>T284792 WP_006249411.1 NZ_CP128528:272782-273171 [Mannheimia haemolytica]
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A547EDJ6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A547EDM1 |