Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-YefM |
Location | 24590..25305 | Replicon | chromosome |
Accession | NZ_CP128528 | ||
Organism | Mannheimia haemolytica strain 142101 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QTV64_RS00100 | Protein ID | WP_006250491.1 |
Coordinates | 24590..25018 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A248ZW87 |
Locus tag | QTV64_RS00105 | Protein ID | WP_006248272.1 |
Coordinates | 25018..25305 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTV64_RS00085 | 19844..21496 | + | 1653 | WP_006248275.1 | phospho-sugar mutase | - |
QTV64_RS00090 | 21549..22483 | + | 935 | Protein_17 | nucleoside hydrolase | - |
QTV64_RS00095 | 22505..24586 | - | 2082 | WP_006248274.1 | ATP-dependent DNA helicase RecG | - |
QTV64_RS00100 | 24590..25018 | - | 429 | WP_006250491.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QTV64_RS00105 | 25018..25305 | - | 288 | WP_006248272.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
QTV64_RS00110 | 25469..27352 | + | 1884 | WP_006248270.1 | molecular chaperone HtpG | - |
QTV64_RS00115 | 27405..27566 | + | 162 | WP_015483997.1 | hypothetical protein | - |
QTV64_RS00120 | 27730..29445 | + | 1716 | WP_006248268.1 | proline--tRNA ligase | - |
QTV64_RS00125 | 29553..29617 | + | 65 | Protein_24 | PT domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 16640.06 Da Isoelectric Point: 8.9269
>T284791 WP_006250491.1 NZ_CP128528:c25018-24590 [Mannheimia haemolytica]
MYRYLFDTNIVSELYKLRNDKMDVNVRQWLRGVNPSQTNISCITLSEIKTGILLKARKDKEQSDRLNDWFENNVLKAYQT
KAFVVNNDIALLASEYHIPNKMDLNDAYIAATAKYHNLILVTRNTKDFIRCDVRLFNPFETA
MYRYLFDTNIVSELYKLRNDKMDVNVRQWLRGVNPSQTNISCITLSEIKTGILLKARKDKEQSDRLNDWFENNVLKAYQT
KAFVVNNDIALLASEYHIPNKMDLNDAYIAATAKYHNLILVTRNTKDFIRCDVRLFNPFETA
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|