Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 823657..824196 Replicon chromosome
Accession NZ_CP128527
Organism Mannheimia haemolytica strain 171096

Toxin (Protein)


Gene name relE Uniprot ID A0A248ZYA9
Locus tag QTV62_RS04175 Protein ID WP_006247804.1
Coordinates 823657..823926 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A547E920
Locus tag QTV62_RS04180 Protein ID WP_006247803.1
Coordinates 823930..824196 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTV62_RS04130 818791..819090 + 300 WP_006247810.1 XRE family transcriptional regulator -
QTV62_RS04135 819099..819257 - 159 WP_006247809.1 hypothetical protein -
QTV62_RS04140 819267..819953 - 687 WP_006247808.1 hypothetical protein -
QTV62_RS04145 820064..820675 - 612 WP_006253310.1 hypothetical protein -
QTV62_RS04150 820724..821350 - 627 WP_006247807.1 tail assembly protein -
QTV62_RS04155 821572..822291 - 720 WP_006247806.1 preprotein translocase subunit YajC -
QTV62_RS04160 822281..822571 - 291 Protein_781 NlpC/P60 family protein -
QTV62_RS04165 822549..823259 - 711 WP_006253312.1 tape measure protein -
QTV62_RS04170 823319..823582 - 264 WP_006247805.1 hypothetical protein -
QTV62_RS04175 823657..823926 - 270 WP_006247804.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
QTV62_RS04180 823930..824196 - 267 WP_006247803.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QTV62_RS04185 824264..824494 - 231 WP_006247802.1 DUF4035 domain-containing protein -
QTV62_RS04190 824539..824940 - 402 WP_006247801.1 hypothetical protein -
QTV62_RS04195 825023..825664 - 642 WP_006247800.1 hypothetical protein -
QTV62_RS04200 825696..826091 - 396 WP_006247799.1 phage tail terminator protein -
QTV62_RS04205 826116..826343 - 228 Protein_790 phage terminase large subunit family protein -
QTV62_RS04210 826493..826867 + 375 WP_006247798.1 hypothetical protein -
QTV62_RS04215 826875..827042 + 168 WP_006253314.1 DNA cytosine methyltransferase -
QTV62_RS04220 827123..827446 + 324 WP_006253316.1 helix-turn-helix domain-containing protein -
QTV62_RS04225 827350..828060 + 711 Protein_794 site-specific integrase -
QTV62_RS04230 828161..828796 + 636 Protein_795 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 812603..838103 25500
- flank IS/Tn - - 828161..828853 692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-75)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10278.90 Da        Isoelectric Point: 6.2121

>T284787 WP_006247804.1 NZ_CP128527:c823926-823657 [Mannheimia haemolytica]
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG

Download         Length: 270 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9913.38 Da        Isoelectric Point: 7.0082

>AT284787 WP_006247803.1 NZ_CP128527:c824196-823930 [Mannheimia haemolytica]
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A248ZYA9

Antitoxin

Source ID Structure
AlphaFold DB A0A547E920

References