Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2311992..2312581 | Replicon | chromosome |
Accession | NZ_CP128526 | ||
Organism | Mannheimia haemolytica strain 171117 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A248ZY19 |
Locus tag | QTV59_RS12185 | Protein ID | WP_006248516.1 |
Coordinates | 2312249..2312581 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A248ZX26 |
Locus tag | QTV59_RS12180 | Protein ID | WP_006248517.1 |
Coordinates | 2311992..2312252 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTV59_RS12155 | 2307171..2308316 | - | 1146 | WP_006248526.1 | FMN-dependent L-lactate dehydrogenase LldD | - |
QTV59_RS12160 | 2308928..2309572 | + | 645 | WP_006248521.1 | RNA pyrophosphohydrolase | - |
QTV59_RS12165 | 2309574..2310362 | + | 789 | WP_006248520.1 | sulfite exporter TauE/SafE family protein | - |
QTV59_RS12170 | 2310370..2311167 | + | 798 | WP_006248519.1 | prolipoprotein diacylglyceryl transferase | - |
QTV59_RS12175 | 2311254..2311922 | + | 669 | WP_006248518.1 | phosphoglycolate phosphatase | - |
QTV59_RS12180 | 2311992..2312252 | + | 261 | WP_006248517.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QTV59_RS12185 | 2312249..2312581 | + | 333 | WP_006248516.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QTV59_RS12190 | 2312708..2313739 | + | 1032 | WP_006248514.1 | tryptophan--tRNA ligase | - |
QTV59_RS12195 | 2313803..2314558 | - | 756 | WP_006248513.1 | M48 family metallopeptidase | - |
QTV59_RS12200 | 2314614..2315141 | - | 528 | WP_006248512.1 | inorganic diphosphatase | - |
QTV59_RS12220 | 2315721..2316755 | + | 1035 | WP_006248509.1 | endolytic transglycosylase MltG | - |
QTV59_RS12225 | 2316766..2317386 | + | 621 | WP_006248508.1 | dTMP kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12007.94 Da Isoelectric Point: 6.4597
>T284782 WP_006248516.1 NZ_CP128526:2312249-2312581 [Mannheimia haemolytica]
MKRGDIYWLDLDPTLGHEQSGFRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLKDAGLKTTGIIRCDQPRTV
DIAQRHGKFIEALPESLLDEIMARVSVIFE
MKRGDIYWLDLDPTLGHEQSGFRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLKDAGLKTTGIIRCDQPRTV
DIAQRHGKFIEALPESLLDEIMARVSVIFE
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A248ZY19 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A248ZX26 |