Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /BrnT(toxin) |
| Location | 1995262..1995784 | Replicon | chromosome |
| Accession | NZ_CP128525 | ||
| Organism | Mannheimia haemolytica strain 171555 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A249A107 |
| Locus tag | QTV52_RS10600 | Protein ID | WP_006249269.1 |
| Coordinates | 1995488..1995784 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A249A190 |
| Locus tag | QTV52_RS10595 | Protein ID | WP_006249270.1 |
| Coordinates | 1995262..1995504 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV52_RS10570 | 1991100..1992189 | - | 1090 | Protein_2044 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase | - |
| QTV52_RS10575 | 1992363..1993004 | - | 642 | WP_006249274.1 | orotate phosphoribosyltransferase | - |
| QTV52_RS10580 | 1993127..1993969 | - | 843 | WP_006249273.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
| QTV52_RS10585 | 1994029..1994604 | + | 576 | WP_006249272.1 | 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD | - |
| QTV52_RS10590 | 1994582..1995250 | - | 669 | WP_006249271.1 | bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA | - |
| QTV52_RS10595 | 1995262..1995504 | - | 243 | WP_006249270.1 | CopG family antitoxin | Antitoxin |
| QTV52_RS10600 | 1995488..1995784 | - | 297 | WP_006249269.1 | BrnT family toxin | Toxin |
| QTV52_RS10605 | 1995911..1998823 | - | 2913 | WP_006249267.1 | RNA polymerase-associated protein RapA | - |
| QTV52_RS10610 | 1998984..1999283 | - | 300 | WP_006249265.1 | hypothetical protein | - |
| QTV52_RS10615 | 1999404..2000729 | - | 1326 | WP_006249264.1 | anti-phage deoxyguanosine triphosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 12009.89 Da Isoelectric Point: 7.9454
>T284772 WP_006249269.1 NZ_CP128525:c1995784-1995488 [Mannheimia haemolytica]
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A107 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A190 |