Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 828735..829274 Replicon chromosome
Accession NZ_CP128525
Organism Mannheimia haemolytica strain 171555

Toxin (Protein)


Gene name relE Uniprot ID A0A248ZYA9
Locus tag QTV52_RS04195 Protein ID WP_006247804.1
Coordinates 828735..829004 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A547E920
Locus tag QTV52_RS04200 Protein ID WP_006247803.1
Coordinates 829008..829274 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTV52_RS04150 823869..824168 + 300 WP_006247810.1 XRE family transcriptional regulator -
QTV52_RS04155 824177..824335 - 159 WP_006247809.1 hypothetical protein -
QTV52_RS04160 824345..825031 - 687 WP_006247808.1 hypothetical protein -
QTV52_RS04165 825142..825753 - 612 WP_006253310.1 hypothetical protein -
QTV52_RS04170 825802..826428 - 627 WP_006247807.1 tail assembly protein -
QTV52_RS04175 826650..827369 - 720 WP_006247806.1 preprotein translocase subunit YajC -
QTV52_RS04180 827359..827649 - 291 Protein_785 NlpC/P60 family protein -
QTV52_RS04185 827627..828337 - 711 WP_006253312.1 tape measure protein -
QTV52_RS04190 828397..828660 - 264 WP_006247805.1 hypothetical protein -
QTV52_RS04195 828735..829004 - 270 WP_006247804.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
QTV52_RS04200 829008..829274 - 267 WP_006247803.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QTV52_RS04205 829342..829572 - 231 WP_006247802.1 DUF4035 domain-containing protein -
QTV52_RS04210 829617..830018 - 402 WP_006247801.1 hypothetical protein -
QTV52_RS04215 830101..830742 - 642 WP_006247800.1 hypothetical protein -
QTV52_RS04220 830774..831169 - 396 WP_006247799.1 phage tail terminator protein -
QTV52_RS04225 831194..831421 - 228 Protein_794 phage terminase large subunit family protein -
QTV52_RS04230 831571..831945 + 375 WP_006247798.1 hypothetical protein -
QTV52_RS04235 831953..832120 + 168 WP_006253314.1 DNA cytosine methyltransferase -
QTV52_RS04240 832201..832524 + 324 WP_006253316.1 helix-turn-helix domain-containing protein -
QTV52_RS04245 832428..833138 + 711 Protein_798 site-specific integrase -
QTV52_RS04250 833239..833874 + 636 Protein_799 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 821394..856664 35270
- flank IS/Tn - - 833239..833931 692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-75)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10278.90 Da        Isoelectric Point: 6.2121

>T284769 WP_006247804.1 NZ_CP128525:c829004-828735 [Mannheimia haemolytica]
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG

Download         Length: 270 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9913.38 Da        Isoelectric Point: 7.0082

>AT284769 WP_006247803.1 NZ_CP128525:c829274-829008 [Mannheimia haemolytica]
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A248ZYA9

Antitoxin

Source ID Structure
AlphaFold DB A0A547E920

References