Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 1041152..1041792 Replicon chromosome
Accession NZ_CP128524
Organism Mannheimia haemolytica strain 181789

Toxin (Protein)


Gene name hicA Uniprot ID A0A378NFX7
Locus tag QTV56_RS05350 Protein ID WP_006250075.1
Coordinates 1041610..1041792 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A378NFW9
Locus tag QTV56_RS05345 Protein ID WP_006250074.1
Coordinates 1041152..1041571 (-) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTV56_RS05325 1036699..1037505 + 807 WP_006248821.1 tryptophan synthase subunit alpha -
QTV56_RS05330 1037555..1038961 + 1407 WP_006253513.1 YdgA family protein -
QTV56_RS05335 1039028..1040034 - 1007 Protein_1012 IS481 family transposase -
QTV56_RS05340 1040172..1040816 - 645 WP_006253274.1 tyrosine-type recombinase/integrase -
QTV56_RS05345 1041152..1041571 - 420 WP_006250074.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QTV56_RS05350 1041610..1041792 - 183 WP_006250075.1 type II toxin-antitoxin system HicA family toxin Toxin
QTV56_RS05355 1041924..1042421 - 498 WP_006250077.1 hypothetical protein -
QTV56_RS05360 1042414..1042794 - 381 WP_006248823.1 hypothetical protein -
QTV56_RS05365 1042869..1043552 - 684 WP_006248824.1 S24 family peptidase -
QTV56_RS05370 1043683..1043883 + 201 WP_006248825.1 YdaS family helix-turn-helix protein -
QTV56_RS05375 1043904..1044971 + 1068 WP_006253284.1 hypothetical protein -
QTV56_RS05380 1044981..1045139 + 159 WP_006247809.1 hypothetical protein -
QTV56_RS05385 1045148..1045447 - 300 WP_006247810.1 XRE family transcriptional regulator -
QTV56_RS05390 1045419..1045808 - 390 WP_006247811.1 type II toxin-antitoxin system RelE/ParE family toxin -
QTV56_RS05395 1045952..1046245 + 294 WP_006250050.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-58)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-96)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6933.03 Da        Isoelectric Point: 10.3446

>T284762 WP_006250075.1 NZ_CP128524:c1041792-1041610 [Mannheimia haemolytica]
MKYSEFLRYLLAQGCEIENHRRGSHRKVTLNGKQSVFPYHGSKEIGTGLVNKIKKDLDLK

Download         Length: 183 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15938.30 Da        Isoelectric Point: 4.6963

>AT284762 WP_006250074.1 NZ_CP128524:c1041571-1041152 [Mannheimia haemolytica]
MLRYPVEITPDDNGTYLVTCPDIPEMASVGEDLEEALLEAQDGLATALEFYFDDRREIPMPSPIKEGQHTVNLTVLQSMK
VFLLNEMIKQGVRKAEMARRLDVHLPQIDRLLDFNHSTKVEFVEKAYGKLNQHFTILPH

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A378NFX7

Antitoxin

Source ID Structure
AlphaFold DB A0A378NFW9

References