Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 822526..823065 Replicon chromosome
Accession NZ_CP128524
Organism Mannheimia haemolytica strain 181789

Toxin (Protein)


Gene name relE Uniprot ID A0A248ZYA9
Locus tag QTV56_RS04170 Protein ID WP_006247804.1
Coordinates 822526..822795 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A547E920
Locus tag QTV56_RS04175 Protein ID WP_006247803.1
Coordinates 822799..823065 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTV56_RS04125 817660..817959 + 300 WP_006247810.1 XRE family transcriptional regulator -
QTV56_RS04130 817968..818126 - 159 WP_006247809.1 hypothetical protein -
QTV56_RS04135 818136..818822 - 687 WP_006247808.1 hypothetical protein -
QTV56_RS04140 818933..819544 - 612 WP_006253310.1 hypothetical protein -
QTV56_RS04145 819593..820219 - 627 WP_006247807.1 tail assembly protein -
QTV56_RS04150 820441..821160 - 720 WP_006247806.1 preprotein translocase subunit YajC -
QTV56_RS04155 821150..821440 - 291 Protein_780 NlpC/P60 family protein -
QTV56_RS04160 821418..822128 - 711 WP_006253312.1 tape measure protein -
QTV56_RS04165 822188..822451 - 264 WP_006247805.1 hypothetical protein -
QTV56_RS04170 822526..822795 - 270 WP_006247804.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
QTV56_RS04175 822799..823065 - 267 WP_006247803.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QTV56_RS04180 823133..823363 - 231 WP_006247802.1 DUF4035 domain-containing protein -
QTV56_RS04185 823408..823809 - 402 WP_006247801.1 hypothetical protein -
QTV56_RS04190 823892..824533 - 642 WP_006247800.1 hypothetical protein -
QTV56_RS04195 824565..824960 - 396 WP_006247799.1 phage tail terminator protein -
QTV56_RS04200 824985..825212 - 228 Protein_789 phage terminase large subunit family protein -
QTV56_RS04205 825362..825736 + 375 WP_006247798.1 hypothetical protein -
QTV56_RS04210 825744..825911 + 168 WP_006253314.1 DNA cytosine methyltransferase -
QTV56_RS04215 825992..826315 + 324 WP_006253316.1 helix-turn-helix domain-containing protein -
QTV56_RS04220 826219..826929 + 711 Protein_793 site-specific integrase -
QTV56_RS04225 827030..827665 + 636 Protein_794 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 811472..836971 25499
- flank IS/Tn - - 827030..827722 692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-75)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10278.90 Da        Isoelectric Point: 6.2121

>T284761 WP_006247804.1 NZ_CP128524:c822795-822526 [Mannheimia haemolytica]
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG

Download         Length: 270 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9913.38 Da        Isoelectric Point: 7.0082

>AT284761 WP_006247803.1 NZ_CP128524:c823065-822799 [Mannheimia haemolytica]
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A248ZYA9

Antitoxin

Source ID Structure
AlphaFold DB A0A547E920

References