Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-YefM |
| Location | 21603..22318 | Replicon | chromosome |
| Accession | NZ_CP128523 | ||
| Organism | Mannheimia haemolytica strain 182812 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QTV55_RS00090 | Protein ID | WP_006250491.1 |
| Coordinates | 21603..22031 (-) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A248ZW87 |
| Locus tag | QTV55_RS00095 | Protein ID | WP_006248272.1 |
| Coordinates | 22031..22318 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV55_RS00075 | 16858..18510 | + | 1653 | WP_040080487.1 | phospho-sugar mutase | - |
| QTV55_RS00080 | 18563..19496 | + | 934 | Protein_15 | nucleoside hydrolase | - |
| QTV55_RS00085 | 19518..21599 | - | 2082 | WP_040080489.1 | ATP-dependent DNA helicase RecG | - |
| QTV55_RS00090 | 21603..22031 | - | 429 | WP_006250491.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QTV55_RS00095 | 22031..22318 | - | 288 | WP_006248272.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| QTV55_RS00100 | 22482..24365 | + | 1884 | WP_040080490.1 | molecular chaperone HtpG | - |
| QTV55_RS00105 | 24418..24600 | + | 183 | WP_006250493.1 | hypothetical protein | - |
| QTV55_RS00110 | 24745..25785 | + | 1041 | WP_289365326.1 | IS481 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 24745..25785 | 1040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 16640.06 Da Isoelectric Point: 8.9269
>T284751 WP_006250491.1 NZ_CP128523:c22031-21603 [Mannheimia haemolytica]
MYRYLFDTNIVSELYKLRNDKMDVNVRQWLRGVNPSQTNISCITLSEIKTGILLKARKDKEQSDRLNDWFENNVLKAYQT
KAFVVNNDIALLASEYHIPNKMDLNDAYIAATAKYHNLILVTRNTKDFIRCDVRLFNPFETA
MYRYLFDTNIVSELYKLRNDKMDVNVRQWLRGVNPSQTNISCITLSEIKTGILLKARKDKEQSDRLNDWFENNVLKAYQT
KAFVVNNDIALLASEYHIPNKMDLNDAYIAATAKYHNLILVTRNTKDFIRCDVRLFNPFETA
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|