Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 700325..700847 | Replicon | chromosome |
Accession | NZ_CP128522 | ||
Organism | Mannheimia haemolytica strain 182963 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A249A107 |
Locus tag | QTV63_RS03550 | Protein ID | WP_006249269.1 |
Coordinates | 700325..700621 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A249A190 |
Locus tag | QTV63_RS03555 | Protein ID | WP_006249270.1 |
Coordinates | 700605..700847 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTV63_RS03535 | 695379..696704 | + | 1326 | WP_020831251.1 | anti-phage deoxyguanosine triphosphatase | - |
QTV63_RS03540 | 696825..697124 | + | 300 | WP_006249265.1 | hypothetical protein | - |
QTV63_RS03545 | 697286..700198 | + | 2913 | WP_006249267.1 | RNA polymerase-associated protein RapA | - |
QTV63_RS03550 | 700325..700621 | + | 297 | WP_006249269.1 | BrnT family toxin | Toxin |
QTV63_RS03555 | 700605..700847 | + | 243 | WP_006249270.1 | CopG family antitoxin | Antitoxin |
QTV63_RS03560 | 700859..701527 | + | 669 | WP_006249271.1 | bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA | - |
QTV63_RS03565 | 701505..702080 | - | 576 | WP_006249272.1 | 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD | - |
QTV63_RS03570 | 702140..702982 | + | 843 | WP_006250575.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
QTV63_RS03575 | 703160..704215 | - | 1056 | WP_006251368.1 | tyrosine-type recombinase/integrase | - |
QTV63_RS03580 | 704175..704450 | - | 276 | WP_006248810.1 | DUF4224 domain-containing protein | - |
QTV63_RS03585 | 704477..704968 | - | 492 | WP_021279670.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 696825..752304 | 55479 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 12009.89 Da Isoelectric Point: 7.9454
>T284747 WP_006249269.1 NZ_CP128522:700325-700621 [Mannheimia haemolytica]
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249A107 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249A190 |