Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /BrnT(toxin) |
| Location | 1947490..1948012 | Replicon | chromosome |
| Accession | NZ_CP128520 | ||
| Organism | Mannheimia haemolytica strain 191452 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A249A107 |
| Locus tag | QTV61_RS10320 | Protein ID | WP_006249269.1 |
| Coordinates | 1947716..1948012 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A249A190 |
| Locus tag | QTV61_RS10315 | Protein ID | WP_006249270.1 |
| Coordinates | 1947490..1947732 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV61_RS10290 | 1943328..1944417 | - | 1090 | Protein_1995 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase | - |
| QTV61_RS10295 | 1944591..1945232 | - | 642 | WP_006249274.1 | orotate phosphoribosyltransferase | - |
| QTV61_RS10300 | 1945355..1946197 | - | 843 | WP_006249273.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
| QTV61_RS10305 | 1946257..1946832 | + | 576 | WP_006249272.1 | 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD | - |
| QTV61_RS10310 | 1946810..1947478 | - | 669 | WP_006249271.1 | bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA | - |
| QTV61_RS10315 | 1947490..1947732 | - | 243 | WP_006249270.1 | CopG family antitoxin | Antitoxin |
| QTV61_RS10320 | 1947716..1948012 | - | 297 | WP_006249269.1 | BrnT family toxin | Toxin |
| QTV61_RS10325 | 1948139..1951051 | - | 2913 | WP_006249267.1 | RNA polymerase-associated protein RapA | - |
| QTV61_RS10330 | 1951212..1951511 | - | 300 | WP_006249265.1 | hypothetical protein | - |
| QTV61_RS10335 | 1951632..1952957 | - | 1326 | WP_006249264.1 | anti-phage deoxyguanosine triphosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 12009.89 Da Isoelectric Point: 7.9454
>T284742 WP_006249269.1 NZ_CP128520:c1948012-1947716 [Mannheimia haemolytica]
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A107 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A190 |