Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 2321883..2322472 | Replicon | chromosome |
| Accession | NZ_CP128519 | ||
| Organism | Mannheimia haemolytica strain 192036 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A248ZY19 |
| Locus tag | QTV54_RS12235 | Protein ID | WP_006248516.1 |
| Coordinates | 2322140..2322472 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A248ZX26 |
| Locus tag | QTV54_RS12230 | Protein ID | WP_006248517.1 |
| Coordinates | 2321883..2322143 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTV54_RS12205 | 2317062..2318207 | - | 1146 | WP_006248526.1 | FMN-dependent L-lactate dehydrogenase LldD | - |
| QTV54_RS12210 | 2318819..2319463 | + | 645 | WP_006248521.1 | RNA pyrophosphohydrolase | - |
| QTV54_RS12215 | 2319465..2320253 | + | 789 | WP_006248520.1 | sulfite exporter TauE/SafE family protein | - |
| QTV54_RS12220 | 2320261..2321058 | + | 798 | WP_006248519.1 | prolipoprotein diacylglyceryl transferase | - |
| QTV54_RS12225 | 2321145..2321813 | + | 669 | WP_006248518.1 | phosphoglycolate phosphatase | - |
| QTV54_RS12230 | 2321883..2322143 | + | 261 | WP_006248517.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QTV54_RS12235 | 2322140..2322472 | + | 333 | WP_006248516.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QTV54_RS12240 | 2322599..2323630 | + | 1032 | WP_006248514.1 | tryptophan--tRNA ligase | - |
| QTV54_RS12245 | 2323694..2324449 | - | 756 | WP_006248513.1 | M48 family metallopeptidase | - |
| QTV54_RS12250 | 2324505..2325032 | - | 528 | WP_006248512.1 | inorganic diphosphatase | - |
| QTV54_RS12270 | 2325612..2326646 | + | 1035 | WP_006248509.1 | endolytic transglycosylase MltG | - |
| QTV54_RS12275 | 2326657..2327277 | + | 621 | WP_006248508.1 | dTMP kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12007.94 Da Isoelectric Point: 6.4597
>T284734 WP_006248516.1 NZ_CP128519:2322140-2322472 [Mannheimia haemolytica]
MKRGDIYWLDLDPTLGHEQSGFRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLKDAGLKTTGIIRCDQPRTV
DIAQRHGKFIEALPESLLDEIMARVSVIFE
MKRGDIYWLDLDPTLGHEQSGFRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLKDAGLKTTGIIRCDQPRTV
DIAQRHGKFIEALPESLLDEIMARVSVIFE
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A248ZY19 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A248ZX26 |