Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 1746011..1746550 Replicon chromosome
Accession NZ_CP128519
Organism Mannheimia haemolytica strain 192036

Toxin (Protein)


Gene name relE Uniprot ID A0A248ZYA9
Locus tag QTV54_RS09325 Protein ID WP_006247804.1
Coordinates 1746281..1746550 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A547E920
Locus tag QTV54_RS09320 Protein ID WP_006247803.1
Coordinates 1746011..1746277 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTV54_RS09270 1741411..1742046 - 636 Protein_1801 helix-turn-helix domain-containing protein -
QTV54_RS09275 1742147..1742857 - 711 Protein_1802 site-specific integrase -
QTV54_RS09280 1742761..1743084 - 324 WP_006253316.1 helix-turn-helix domain-containing protein -
QTV54_RS09285 1743165..1743332 - 168 WP_006253314.1 DNA cytosine methyltransferase -
QTV54_RS09290 1743340..1743714 - 375 WP_006247798.1 hypothetical protein -
QTV54_RS09295 1743864..1744091 + 228 Protein_1806 phage terminase large subunit family protein -
QTV54_RS09300 1744116..1744511 + 396 WP_006247799.1 phage tail terminator protein -
QTV54_RS09305 1744543..1745184 + 642 WP_006247800.1 hypothetical protein -
QTV54_RS09310 1745267..1745668 + 402 WP_006247801.1 hypothetical protein -
QTV54_RS09315 1745713..1745943 + 231 WP_006247802.1 DUF4035 domain-containing protein -
QTV54_RS09320 1746011..1746277 + 267 WP_006247803.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QTV54_RS09325 1746281..1746550 + 270 WP_006247804.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
QTV54_RS09330 1746625..1746888 + 264 WP_006247805.1 hypothetical protein -
QTV54_RS09335 1746948..1747658 + 711 WP_006253312.1 tape measure protein -
QTV54_RS09340 1747636..1747926 + 291 Protein_1815 NlpC/P60 family protein -
QTV54_RS09345 1747916..1748635 + 720 WP_006247806.1 preprotein translocase subunit YajC -
QTV54_RS09350 1748857..1749483 + 627 WP_006247807.1 tail assembly protein -
QTV54_RS09355 1749532..1750143 + 612 WP_006253310.1 hypothetical protein -
QTV54_RS09360 1750254..1750940 + 687 WP_006247808.1 hypothetical protein -
QTV54_RS09365 1750950..1751108 + 159 WP_006247809.1 hypothetical protein -
QTV54_RS09370 1751117..1751416 - 300 WP_006247810.1 XRE family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1732104..1757604 25500
- flank IS/Tn - - 1741354..1742046 692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-75)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10278.90 Da        Isoelectric Point: 6.2121

>T284731 WP_006247804.1 NZ_CP128519:1746281-1746550 [Mannheimia haemolytica]
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG

Download         Length: 270 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9913.38 Da        Isoelectric Point: 7.0082

>AT284731 WP_006247803.1 NZ_CP128519:1746011-1746277 [Mannheimia haemolytica]
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A248ZYA9

Antitoxin

Source ID Structure
AlphaFold DB A0A547E920

References